7 == S=N ay<=}y<@YAay<=~y<ZDay<=~y<@ZGay<=~y<[Jay<=~y<@[Ma<=< Pa<=< SaS<=S< VaS<=S< YaS<=S< \aS<=S< _aS<=S< baS<=S< eAm ===1<hAm ==I1<mal<=l<ral<=l<ual<=l<xal<=l<{Am ==4<~!eo<=eo<c!ho<=ho<c!ko<=ko<c!no<=no<cAm ==< Am ==<!a3=="5 a3=="5 a3=="5 a3=="5 Am == ="Am ==X =#===$==Gk<%==GS7&==]7'==r<(c===) ==y<*+,X==Gg,5-S==|Y7./A==U=0==T^T/==8k<1==q<2Am ==Q;3;==\74==C=56$==A7 789:;<==],==='5> ==<'5?@ABCDEF==V7GHJ==E7I==GJ7J==Y7K"==\7L'==$b<MNO,O==<*PQRSTUVWXYZ[\1z==<ef6==X =g;Am ==w=h >)==R<ijklmnopqrsD8==R<tuvwxyz{|}~I ==R<N"==R<S==R< X K==R<(VWXYZ[\]^_`ab]8==R<jklmnopqb==R<rstuvwxyz{|}~g!==R<l==R< q==R<XFGHIJKLMNOPQRv@0==R<rstuvwxyz{|}~{X==R<F6==R<L==R<H==R<R==R<      S==R<        ==R<rZ [ \ ] ^ _ ` a b c d e f \==R<2 p7==R< <==R<  ===ld-2.2.5.so===libBrokenLocale-2.2.5.so===libanl-2.2.5.so ===libc-2.2.5.so===libcrypt-2.2.5.so===libdl-2.2.5.so ===libm-2.2.5.so===libnsl-2.2.5.so===libnss_compat-2.2.5.so===libnss_dns-2.2.5.so===libnss_files-2.2.5.so===libnss_hesiod-2.2.5.so===libnss_nis-2.2.5.so===libnss_nisplus-2.2.5.so===libpthread-0.9.so===libresolv-2.2.5.so===librt-2.2.5.so===libthread_db-1.0.so===libutil-2.2.5.soAm ==D = Am ==A = Am ==A = Am ==D = Am ==* = Am == =  ==cy< Am === ===../bin/busybox===../bin/busybox===../bin/busybox===../bin/busybox===../bin/busybox===../bin/busybox-0.51===../bin/busybox ===../bin/busybox#===../bin/busybox&===../bin/busybox)===../bin/busybox,===../bin/busybox/===../bin/busybox2===../bin/busybox5===../bin/busybox8===../bin/busybox;===../bin/busybox>===../bin/busyboxA===../bin/busyboxD===../bin/busyboxG===../bin/busyboxJ===../bin/busyboxM===../bin/busyboxP===../bin/busyboxS===../bin/busyboxV!== = Z#===          ! " _Cm ==* =` bAm ===a fAm ===b k===../../bin/busyboxp===../../bin/busyboxs===../../bin/busyboxv===../../bin/busyboxy===../../bin/busybox|===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox ===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox===../../bin/busybox{===c d e f g h i j k l m n o Am === "===../../bin/busybox'===../../bin/busybox*===../../bin/busybox-Am ==< = /Am ==Q = 4Am ==26 9===/mnt/var/log/packages>===/mnt/var/log/scriptsAAm ==_5 D===/tmpI==j,5MAm ==8 = Q===logV . ..  lost+found binC bootD dev etc& libP mntT procU rootW sbins tmpt usrPvar ... . .. busybox ashH catchgrp3chmod chown ` cpGE cpio date dd  dfBdmesgeXdumpkmap echoegrepfalsefdflushgetopt0 grep gunzip! gzip"hostname# kill$ ln% lsI&mkdir'mknod>J!(mktemp) more*mount+ mtZm, mvv-pidof. ping/ pss0 pwd 1 rmw2rmdirP3 sed4 sh'5sleep36 stty7 sync8 tar9touchB>: true;umount<uname!$=usleep}> vi? zcat@ busybox-0.51Anetwork1BpcmciaeZs=^Q.8PGSq"]EILgԃ q.X:۬W㉠MI 7ϼh;6D2] Wܱro# A$$Cv/H_7߉*L˙q GWYh̔7ׇC] jE;5iD0'~ piHELF4P4 (444  d@( (  /lib/ld-linux.so.2GNUNBry7Y gV,K)Cjol  b(.FOiq}@Dt 2:pWI6G%/ <~ P 5'-9 =40[ehASXu;H+v`]&Zmwn 1M\_E^"fUaRd3Lk#xs8z!|>?c*J$Q {Ta=(G8(BHMX;2- h/xXIA;ȮLخ~o|g(8zHL. X<h_x/pI/Gȯ*"د=7.$:%7:` \(7-8;HX-h/x7-%;Ȱ3ذn7"=^X(=8")HiXIZh;x+,4r/ 1; GȱرHF/IW|(3. !8MH/XRh.x:GT<p ;Ȳ;زi: (C8=H:~Xh3x/x- s/7ȳس:XC^=j(8%"H@X; hx7-PU. h. s. ȴ:fش%` P/C(;z87H>X, hx~B<A;03ȵص77p(8<&H XUChxYb(7r$ȶ7. ضD(;%E(,F8/4HX=hx77 ;v;ȷ7Wط+Rw3;(Pi81. 1. HbXY<hx2:v=ȸ=2. ![ظ[H.7c.\(78<YHvX{h;#x;Q1O=$ȹعBuWI2/P(.8SH(sXhvPx,-5`.ȺغL=?,x;(1A8GH,0 CX6hjx:0 W+H2{IxfȻػ7,$ 0 MI4$ ^(;i8pH-X;hbx:=|ȼ :ؼn0 {=7;(0 8'HvX(h/U "x7"libc.so.6longjmpputcharstrcpychrootunsetenvsys_siglistwaitpidpauseioctlwritevgetgidsysconfstdoutvsprintfutimecfgetospeedconnectungetcsigemptysetstrerrorfdopengeteuidmemmovegetopt_longatolgetgrgidtimesre_syntax_options__ctype_bgetenvfchmodgetegidsetlinebufsetprioritygetprioritybsearchusleepexecvegetprotobynamegetpidgetpagesizeqsortfscanffgetsdirnamememcpysetitimersetvbufexeclpcloseglobperrorreadlinksetrlimitdup2getuidsystemfeofmallocremoveisattycfgetispeedoptargsysinfovsnprintfrecvfromstatfspivot_rootstrtoulgethostbyaddropterrrmdirsocketselectinit_modulereaddirlchownre_matchdelete_modulefflush__ctype_toupperftruncaterealpathputenvlseeksigaddsetstrncasecmpsetpgid__udivdi3abortalarmpopenstrtolpipe__lxstatunameacceptcfsetispeedrenamestrrchrcallocstrtodkillctimestrcatre_compile_patternbindinet_addrumount2mkfifo__deregister_frame_inforebootchdirsetsockoptfseekwait3cfsetospeedoptindmemchrswapoffstdinwaitfnmatchumaskmktimeferrorstrstrsignalopenlogcloselogstrncmpquery_modulesethostnamestrncpyunlinkstrcasecmpsendtorealloc_IO_getcstrtoksigfillsetlistenforksscanfsetmntentstrncatexeclpsigactionendmntent__res_initkillpgfreadstrdupinet_atonregcompsymlinkgettimeofdaygetoptlocaltimememsetcfmakerawftellclearerrgetcharinet_ntoagetppidtcgetattrregexecopendirgetgroups__assert_failbdflushsyslog__xmknodgetopt_long_onlysys_errlistherrorstrcmpshutdownttynamegetpwuidswapongetcwd__res_stategethostbynamegetpwnamgetservbynamefgetcgethostnamefclosestrcspnregerrorstderrumountmkstempstrsepfsyncfputcglobfreestrftimegetmntentfwriteaccess__xstatfreopentcgetpgrp__errno_location__fxstatstimeklogctlgetgrnamfopenatoi_IO_putcfileno_setjmp_IO_stdin_used_exitstrspndaemon__libc_start_maingetrlimitvdprintfstrchrfputsadjtimexexecvpsetsidclosedircreate_modulefcntlsetuidgethostidtcsetattrmkdir__ctype_tolower__register_frame_infovfprintfstrpbrktcsetpgrpraisesigprocmask__environ__dso_handle__cxa_atexit__gmon_start__GLIBC_2.2.3GLIBC_2.1.3GLIBC_2.2GLIBC_2.1GLIBC_2.0si dsi pii |ii ii - @-  - . . . r. s. t. . 0 0 0 0 0 ) ) ) ) ) ) ) )  )  )  )  )  ) ) ) ) ) ) ) ) ) ) ) ) ) * * *  * *  * !* "* # * $$* &(* ',* (0* )4* *8* +<* ,@* -D* .H* /L* 0P* 1T* 2X* 3\* 4`* 5d* 6h* 7l* 8p* 9t* :x* ;|* <* =* ?* A* B* C* D* E* F* G* H* J* K* L* M* N* O* P* Q* S* T* U* V* W* X* Y* Z* [* \* ]* ^* _* `+ a+ b+ c + d+ e+ f+ g+ h + i$+ j(+ k,+ l0+ m4+ n8+ o<+ p@+ qD+ uH+ vL+ wP+ xT+ yX+ z\+ {`+ |d+ }h+ ~l+ p+ t+ x+ |+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + + , , ,  , , , , ,  , $, (, ,, 0, 4, 8, <, @, D, H, L, P, T, X, \, `, d, h, l, p, t, x, |, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , - - -  - - - - -  - $- (- ,- 0- 4- 8- <- @- D- H- L- P- T- X- \- `- d- h- l-  p-  t-  x-  |- US[ô{[ [5) %) %) h%) h%) h%) h%) h %) h(%) h0%) h8p%) h@`%) hHP%) hP@%) hX0%) h` %) hh%) hp%) hx%) h%) h%) h%) h%) h%) h%) h%) hp%) h`%* hP%* h@%* h0% * h %* h%* h%* h      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%* h% * h%$* h%(* h%,* h %0* h(%4* h0%8* h8p%<* h@`%@* hHP%D* hP@%H* hX0%L* h` %P* hh%T* hp%X* hx%\* h%`* h%d* h%h* h%l* h%p* h%t* h%x* hp%|* h`%* hP%* h@%* h0%* h %* h%* h%* h%* h%* h%* h%* h%* h %* h(%* h0%* h8p%* h@`%* hHP%* hP@%* hX0%* h` %* hh%* hp%* hx%* h%* h%* h%* h%* h%* h%* h%* hp%* h`%+ hP%+ h@%+ h0% + h %+ h%+ h%+ h%+ h% + h%$+ h%(+ h%,+ h %0+ h(%4+ h0%8+ h8p%<+ h@`%@+ hHP%D+ hP@%H+ hX0%L+ h` %P+ hh%T+ hp%X+ hx%\+ h%`+ h%d+ h%h+ h%l+ h%p+ h%t+ h%x+ hp%|+ h`%+ hP%+ h@%+ h0%+ h %+ h%+ h%+ h%+ h%+ h%+ h%+ h%+ h %+ h(%+ h0%+ h8p%+ h@`%+ hHP%+ hP@%+ hX0%+ h` %+ hh%+ hp%+ hx%+ h%+ h%+ h%+ h%+ h%+ h%+ h%+ hp%+ h`%, hP%, h@%, h0% , h %, h%, h%, h%, h% , h%$, h%(, h%,, h %0, h(%4, h0%8, h8p%<, h@`%@, hHP%D, hP@%H, hX0%L, h` %P, hh%T, hp%X, hx%\, h%`, h%d, h%h, h%l, h%p, h%t, h%x, hp%|, h`%, hP%, h@%, h0%, h %, h%, h%, h%, h%, h%, h%, h%, h %, h(%, h0%, h8p%, h@`%, hHP%, hP@%, hX0%, h` %, hh%, hp%, hx%, h%, h%, h%, h%, h%, h%, h%, hp%, h`%- hP%- h@%- h0% - h %- h%- h%- h%- h% - h%$- h%(- h%,- h %0- h(%4- h0%8- h8p%<- h@`%@- hHP%D- hP@%H- hX0%L- h` %P- hh%T- hp%X- hx%\- h%`- h%d- h%h- h%l- h%p- h%t- h%x- hp%|- h`1^PTRhhЭQVh`HUS[kt[ÉU= u> P С 8u8t h(  ÐUUȯth0 h( _ÐUÍWVS$$1D$$&50 jD$$L$ f50 JD$(L$ It&50 *D$8L$ )t&50  D$LL$!@ t&kh!WST6;0 tCvD$P;Ã}h+t$(t$(t$(t$(t$(t$(h@1҃ = tU1t&D$$# t6t5. hŹ%5.   uɹw< PSt$Lt$Lt$Xt$Pt$Pt$Ph0[^_ĐÐUWVS11> w+$ *%t& hD$.u~/u ~tSVǃWV8}%SD$ P!ƃuSh@1[^_pÍvlUWVS$D$UuW X \ S }/uHS yvl/CW D$<.u ~|$u S y1l/CD$>t S ylÊFC>utO=S ukD$P5X j|D$(%=uD$ƅ40 @0 U5} }G1|$uP]$t=3 t5| hRP1[^_]lÍvW u1É/tt@/tu8uW  @W à UWVSt$ |(t =| W u jj<VgVsW X \ S  >/-| }t S y\jÊEEC}u}/S K&u;X v_S K;/uQt&}tF迳t1 S yi/ S yiÊEEC}uŅu;X u S yi/C=S u|ij5X 3[^_] à j/| u | W  ÐS\$ |$$tj5| hx0 @0 | =W tPu| W u {t&S߾| j5| h [ÐS\$ |W j5W S0 t 0 @0 \0 \$SjSj =S t=3 t j|jjTj [ĘÍvS\$$0 0 @0 t:W tPhX{t$,S5. nj t$, D$Pt$j D$Pt$t$hSL$ \$$Rs.v9uBtQ(RrQhRj h0 K0 [É 0 H0 0 u0 tW Ív 0 0 t5 ÐVSD$ L$$YX \ S q S ycfŠCB;ut S x ;f ؍t& S y#fS \ )‰PcÃjSW [^à WVS\$0|$4t$VqdSDWPj V}d jy=S u)D$PTd[^_ É D$t P Ð,UWVS|$@l$,Uct$(v_t0vW W j#VS&=W [uӋD$W W \$t{jsw 8D$\Pwq W tEu W =W  W %=W u! W =W W u W U'c[^_],SL$B<v_tҡ0 DPu 1-0 AB<v_tCu=[ÍvUWVS$4D$ $PsbT$XT$\D$PD$TD$XW W W 8T T$D$@Xtt&jD$HPS$[u拔$0Z jD$PPS$[tj|$Ht߅t_D$Tp 1t tst jvjD$PPSl$[uƋD$LD$D$<pHD$8\$Xt D$(uT$4Ps`D$<\$XtCT$,T$,uD$,D$$=3 t=W u|$(~PT$$D$()D$,=3 t2j+t$\Z t$TKj |$(u+D$8W D$-u/D$,L$(tKD$4e T$T$4l$D$4PU\$@ST$825D$H$0xu|$8uBT$ u9j$<PIƋ$@ZSRVbJ kL$ D$8W W j$<p觓$jh U PL$U T$HJ U D$L(U 0 @0 S $S  D$\P(=W u$PpF&,U $0U $h U kp$jPh U  $S $W jPW $T$PW \$@ts蜪uW D$(Pt$HQ W 0 @0 蓫$S ,U $0U $h U o$ jPh U $W +2=W uW W D$ o5W 4W 9D$<؃S$<r}W $T$@tt$L7D$@W DŽ$D$\Pt)W $$uW VW $D$PW T$,W 4U  u=W  =W D$\Pv W =W ujv=W t=W u W =W  W Ã=W u W =W  W  W W D$\PV&|$u&tjwcSwL u!0 @0 U1AW [^_] ÃS\$ tqT$RW W |Rj Rs D$@C0){t#jRsjD$ pS!r [u[É,UWVS|$@t$DD$,D$ PhRFFF uW vW \$$S}h[t&jW)<ŃjWU= uWst$${t(jjs s3 jWt$(D$(n D$ PQ[^_],ÐS\$ ;u7C t0p)t8T PjD$PC p' [ÍvW ÉS\$$|$ ~s6ZvW 9~…~8cu W W 1[à |$~D$ pYW =W u W  W W  ÃS\$ ;0 thj”j踔 j諔jG0  = u+t'h h`u  [Ív 3 Pm3 P0 ÉS|$ ~U3 3 W tt&jsWuj8T P6PD$0P41[ÐS\$ tsh$du[É UWVSl$ |$,j/u$tD$(PUu0^>Oy.=W u%D$(PUSttƃSfNuD$4PÃut u d ~t&d t&d jV?PuhjvSV W s]&tE:t@0 @0 RV t-V PQ1W r[Ð W  x W 1&ƀ3 @~Y<W =?W s8u@=?W r跘 Ív S y*S S  S  S ÍvSl 0 @0 C| PCtP){ul Sl B S B3 BS Bh [Ð =l 3 t`=l 3 u à l @~Psl @ ÃVSt$ \$$jjVt,l @t&(l xul pxuh 莢ƒl PS 3 h [^ÐVSt$ 0 @0 jV5Ã}Vh* -j S|ƃSm }ht$,Sx[^ÍvVSt$ \$$t$,SVuK0 @0 jV/3&U W CP\jO[^ÍvUWVST$0u1ƉFt<:t<%uD$@Pl)D8D$,9\ }JT$9\ |X 9tWUS/CD$%uF5W t<:tFt<:u>:u FT$02t&D$0T$(RH[^_]É D$0t$ à hdjjht$,; ÃUWVS1rtmvtVuh:]ǃu١4U uT 3 3 s,tf{t USUu3 r10jl1ƃ4U jV9 ÃtCftfu=` | jV8t$vupVh:PEVt)vu Vh VhR`8T PjD$ PV |$u3t/jVnÃtvPS*\4U 04U [^_]ÉUWVSl$4tP|$8 WhT$0BfuEr8T D$WD$(PÃSF NySvfutlh%Zt&fuPtL0 @0 hT$Lr=à SWh3S W T$8z t'PhR[^_]ÐVSh@11v@P u PhiÃ<~hn1ۃF$vhp1[^Ð|UWVSj/$P$t` $@gD$(P$RjO|‹$@0&$B&D$$tD$,P$Dǃ` D$$'j$PÃto{ uiCfu$yD$Egfu9{}3fS` }D$$|9}89*$P\1t tt%f{$t uD$u |$$}MtI|$u$p0 @0 j$RqfCsD$ t{ tf{u ` D$ ST$ D$VWCE9|D$W tjPhsXLt)$P=ƃ&]&$H5W h{L*>/uA;l$ ;9}7;l$ D$D$(PVjv|D$ D$8%==W thV螚@PA V?j$Rà tf{tV$PhVA|$0 @0 j$RfCkN$P$PBƃ%t |$t $t(jD$,PP$RhpV $+$jC C$CB[^_]|Ív D$@Pt$= É hjj%ht$, ù 3 3 s8t't&Pftfu =` |@ uރ3 rÉD$Pt$,=` }T$ |` PD$` ÐWVS|$ 0 @0  3 3 sOt6Bfu9z}fu9=` |RӋuʃ3 rN[^_ÍvWVS0 @0  3 3 sAt.f{usSy ދuԃ3 r[^_ÐWVS|$ ?tt&A9uЙ 3  3 t&ދtWC P3u|$$tSuO0 @0 W  P覕fCC WC PJ5W [^_Ív 0 @0 W  Q] Ð jt$tfxup& ÉUWVSt$0l$41D$9}/DD$D$4U W W S \ )‰P;X X t:hX ShX X X V5X  8vtjSEjd;‰ZX X X X t GX G[^_Ð,UWVSt$@D$DD$,d$,D$(>~utRVƃF(t{vtSv:=9>u ~@u~=tL$D{ S W t&|$,t! S xW  5<W W F S W >^|$$d$$\$ D$VB<v_tҡ0 DPuD$j=S苶X|$tPD$,P 1҃/T$,Rqƒt t :u111X  W )L$|$$|$tDD$HP%PT$,R |$$ u\W +5X +t$)W 5S <|$$ uR貑%L$0Q}PR |$$u1҉}L$ 9@u= U tD$$H >$5W VW WX W )‰PL$$QD$LPS S x W  v9W W X 5W )ƃT$0RWL$$QD$4PVjS uW +X )@)‰W S T$$R!%u~=u|$(xD$(T$LVt& S xW  ;8W W 9[^_],Ð UWVSt$ D$$Ńt3t&t t/t:t t&cuFuuh蟀t7GPlt @8tUh¾Pt [^_] ÐVSt$ = X 95X ~d=W t20 @0 W P趽W /=W u95X ~ X  X W 5X m X W W  X  X t=9p|+t&0 @0 P0 X  X :uΡ X 9p~p[^ÍvUWVSt$0=S  j 6W  S W W -X W Xxt'9r vK;t9s;th xt&9v{u;t ;uCC;u{"D$)WXtjCP{D$$PsV臭T$,}$uhBVhQPhej S誺Cu|$ujU)PW W )@)‰W S [^_]ÉpWVSW D$+X D$ $t D$D$$T$DŽ$`DŽ$dDŽ$l0 @0 W W $B$B$B $ X $W $p $p D$4Pǃu]W D$$D$(W (S \ )‰P1ƃ$xP$P T$ RVu40 @0 W $W $B$B$B $ X $W $p $d{&H$hFtc|$t8ËT$< u+ S xD$@D$t&3D$D$ S x T$BT$2D$D$$hH$h$hx$`|(h$S$lPp;X t&S L$9D$v T$z t拄$`|$lP3$dt$pPŸ$lt$xPW D$$W t jP$ujD$ +X PD$,P#T$W [^_pÍvUWVS|$4D$<1D$5p W T$p hPL$u|$u+;t$0v%|$tj'‰rL$DAQ[^_]ÃS=W t9&0 @0 W PW f=W u X W [ÐSt$,2Ãj '‰ZX X  [É0WVS\$@=3 jsǡ0 @0 t$ VjjWt t=kvD$xu0WStVcVz v=VgfX js X  h$7[^_0ÉSD$ X3;u[ÍvWVSt$$\$(jt$,ǃtjVjPWŨ[^_Ív UWVS|$ t$$\$( S S \ )‰P[%ŃSVWjà 5W U'؃[^_] Ð UWVSl$ h1U7ÃuxډD$$t`)R}DP$lj t;VUWL>(~80[^_] ÃUWVSl$0u)W tW @|u[h̰}%UB< wDEP$ ;W W @|D%u }p1W 5W Nx@{t4f{~-C pEPYttUh,߃NytUaD$$PUFt<W 5W Nx-t&{tf{~C@C T$9PtNy׃Uh:譯[^_]Ív UWVS W W I0 @0 W uj`dlW |@`PGlÃW @P5W S/1ɃW 9}$-W lj1.9D3 uT3 A9|5W W W @W ¹W W @DW IyCt&{t  0 @0 CCCfCW C|$$~T$$RPQkC [ ݮ[^_] ÍvUWVSt$0l$8J0 @0 踑ǃu蠮hT&S D$S gW |$x=3 totf~u GF Sjsu&Sja}’0h`RjWjW et&u[j5Yj+Y tf~u9= u0j^jS tShڬW 5W Nx{t S Ny|$=3 j:Wj0W j#W&=S t/t*=3 t!tf~uF SW#u=x tMF@V fF;CCW =3 t#=S t|$4tD$@P* Cc[^_]Ð0WVS$@菎ǡ0 @0 W =W uE$Sjj苍DŽ$`*D$,PSjp vVj=~t=W u0jD$ Pj:=W tjčPn~t-Wj}K0h{۪&~u++W ЉЉ@W F@F Pуu Ӂ!u% t&~t(1ttu jW~u Vy豪[^_0ÐUWVS\$0t$4T$=W u jPR\Ńuu (8t…F0 @0 D$W W @9&{D$K C@9sBt'9u D$A\$Au D$<u1 C@S 9r|$tUtC9t?St8+W ЉЉ@9W u W W @W 95=S t=3 t9t$D$ǁ<u Á Å 9t$tUhK#uG=S t>=3 t5+5W ЉЉ@Ph"?- tP/t&Sh"thj |$tD$@[^_]Ív =W t%1Kh軜W *W  W 9xtxtB9~1 ÐVS1=(X \$ $X u Cft&u$B (X =(X ~{B3CA=utB1(t&u }A|<w (X  B (X =(X .B.B.B Ce$X [^ÃVSt$ {`$Hvh v;vh vvvyh v^t&^t&s9;th`uhCv hpveh v hv ht&hhvih vNh fhsv h hhKFp= huv"h# ]^ t/S{thP[u׋^hPSz [u&vt&*Kt&,;t&/+t&2t&57:19Ft"F0D$ffD$D$PS wF 0D$D$@P-t&v vh=hC[^ÉVS\$ h_ƃ5$X (X S8$X [^ÐW Ð|UWVS$t ,X  =,X l$|US$T  u (T  T D$1v:tpЉ@8u@D$PRjΉ}D$D@X ;9D$D~)$uW uPhRD$D;F;5,X }hW D$ Pƒc5,X U[^_]|ÉShsPW h>W  h)W jj̄D$0 D$0P0 @0 W t tEMvt+C\S S @U D$d W t&W =W t-D$t=3 t =S u5W  Mt&=W u j 謕D$ PhˠD$ D$D$%t&D$$W zS S D$ P$R$P $t58-u0D$hD$hD$hOt8tD$PD$=3 t =@U t41ۍv4 ICv@U tjPl=3 u =@U u j5W lKUWVSl$01\$S u=3 hœG9&t.=3 u%=W  W 1jRUSeS0 =W uW et&=W tJJ1=3 t!tFjHjZ VIƒS Lt 1D$P[^_]ÍvWVST$ 110 @0 jR8Ã|jS4|d=3 t*=3 t 3 =3 t 3 jO=3 tt3 t3 [^_ÐS\$ 0 @0 jS莉|jP茶Shuj脵[ÁUWVS$W W t"j sYP*Kuރ)l$xU+$p8T D$j/V+~t7XD$PSj调uD$$%=t1SVD$P7ÃuVht~5D$|jh U P_$U G U $(U jSϵW j ;~'h U $jPh U  U>W [^_]ČÍv `t18|$~D$ p W  W W 5W XG ÃVS\$ ;\ ~Kށ0 @0 FP?WƒT BX 5\ T 趚X X )\ [^ËL$X 9r T 9s T )\  X ÉT$T X B\ B2 B 2 ÉS\$ 0 @0 C 2 vT T P肇9T u݋CX C\ [Ív UWVS-\ mg=X 5T F9uv1 tn0 @0 T CPV'VT  T AX \ 2 t92uω؉:JBR t92t?&SƃUWV蒄5X \  [^_] ÍvS\ p |-~%S5X PKS X t&\ )HS X [ÐVSt$ S \ )\ )أS 9rX [^ÍvD$L$X )\ \ X ))ʉS U,WVSE1t&pu 8U  vEh uՅtj迅t  X I54U >u h 1hGǃuEEEX \ S E}t'E<  S &}u<\u E< }t? uPWxE}t$}\ujEPj脆_~tYEPWxtD=S uj5X 6CEX \ S  S ybÊECjEEPjE=S u&Ít&K9X wPWwuj5X  vjhW 6GC>uEe[^_ÐUWVSl$41h_u0 @0 jxÃSx 脕4U 01u D$r|DwB@uDxBt$21 u D$ruDwBuDxBL$ 1u D$ruDwBuDxBD$PQVhvSh-< w51ۍv<vuh3\F>uۃe0 @0 V6ǃt ӁSWi5ÃW辁 :uVhF萓ӁSCw1[^_]É,UWVS1D$$D$fNSt'Ht>at)7&D$$(D$$D$Ãh9 uXXD$t}tE 9u}uSh诒 4U D$ txӃ|$uyth{&޿ 1t t51C/~9|B鍴&t h#}|$X|$\$0SuhD$$t|$( D$$t{uh~}uht&1uǃ1RPhN}}ut&t$0Vu|$ t7D$$t~D$$t|$(Vu[u}Yh3D$$t|$( D$$t~uh1uǃ1RPh|1[^_],ÐSL$\$ 9tCA8t1[ÐSL$\$ 1Ҋ< wTPA9u1[ÃS\$ D$PSuSh3]D$ [ÃUWVSl$0X D$\ S t$hUyÃh+T$4RO}ǃ څtStt1 vG‰T$@9S sPD$,t&D$'tD$@SUP{'Fl$(t,u \F'E"t>FWUPr{"T$T$S )УS }HS D$S \ )‰P[^_]ÃVSt$ VZMXSz SVPz[^ÍvS\$ UW $sss ssss ysn s L¡W @УW ύt&s>s asZL¡W @УW  .s s s t&s[ÐS\$ tW su[ÃVSt$ u1SW UأW -$pt&vvCv C vCFvCFt&vUv EC v7C v ݉vGvv uC v뾐t&vCF v C FCvC vC[^ÍvVS\$ t$ t+W W sf‹P6uD$ [^SL$W ASt ABuW [ÐVSD$ t$$54U ~F4U 1&3 @~j74U 8u=@U u3 =3 u2=3 u)jytjuyt3 =3 u 3 3 1<u@~U =3 u;=@U u2W 4U U 4U jP@U W 4U t=@U tt U 4U 4U (U ,U 0U 8t U 4U P4U xu聠[^ÍvUWVS|$0@U 4U B4U G-uhD$t<-z|$0u3 3 sBz`PO+t 4U =D$vcu;|$0t44U 4U t =@U t h0@U o4U (uLh[~13 tP @PhtF~Rt&1 @PUltF~݃Uh葈T$$R PN4U 8t4U T$$RP)G4U 84[^_]ÍvSL$ \$$1ҋ 9u3 t.Vt"Eu$ 3 B~σQh$߇ 3 [Ív UWVS\$ 1;tG<uPDŃ;t"&P*E;uh U 2$U = U -(U ,U 0U [^_] ÃVSt$ Ft,^;t3&u;uFPu[^ÉVS|$ ~D$0pHƃ U 9~ h7贆0 @0 ) U (U Nx t&=$U t 3tNy(U u,U 0U 1[^Ív |$ut$jP8:0 @0 j]4U 8t P#胆1 Ð t$M,U 0U  Ív tuNC†ƃ>u &u |u 詆CtƃtkqjCjX X'ƃ-uX @ 1X @ %v |$t D$ЉCX t迅Ɓ~1(tQ{tGFv_t:ѡ0 DPu)u S \$D$C\$D葅Vt&(u Z(pD$(/ S D$D@D$D+X D$ S T$DBT$D{u,ƃ#uƃ}u # t& 1{Fvs_t,ѡ0 DPt]_tӡ0 P S xT$DBT$DD$DD$DiƁ~mFve릐FЃ w( S D$D@D$D4ƍFЃ v6t&t S L$DAL$D h S x\$D=C\$DsD$D=D$D1ui%t= #t6t&:u 襃ƃVhzLt-zx,#un9uG 胃||$<u|$4t̀X ȋ\$D$8|$<D$,lX D$D$\P>Yt?$t$PWlX D$LW jP[Sv0 @0 DŽ$|$D+=X ~-W&$$W5X PzUW D$LT$PW i|$(]5X \ S =tX tj=tX  à ~}\t`́à u(h =pX tjjm\t)`t$$t|$<t"t S y\F'h X h0h pX tX  S yƈFt& S yF+5X ~$S  \ )PPZ \$H|$Ht t&;ujSD$8lX tpX T$pX jƃ|$(t L$ pX wt jp|$(t胀S  9=\ ~X \$D\ S $tL$WPSS\$T)=S 0 @0 $PUDŽ$  sgD$lX D$LW |$4u|$<t S T$De S L$DmD$4|$4uU\$ \$$D$  S D$D@D$D|$<t S "4& S T$D BT$D S L$D(AL$D[^_]<ÐT$t$DVSj2G j@D$-u ~u1VKƃD$ V 8t PCD$ 4t PU;g1[^_ÉWVS$V u;t=S tPuKGwC$(=3 u=@U u =3 u!=3 t =3 tV V uOD$PjW6|$u%=3 tGwƇV ƇV ;tf9t_ttD$yD$D$DŽ$\$ D$$P AjSW6 [^_ĠÍvVST$ ZW 3<vjR73[^É D$u=V uR ƀ?W W  ÍvSt&@W =@W uȃ>.@B8tDW j4V TW W [ÐL$PJBuFD$P6BuM$W V t8tV jPpTD$W jř$\P2At$(D$Pt$,p.tT$ ЃÉVStCt&Cu0v ‹v4CFCF C u[^ÍvUWVS|$0l$8D$1ۊB<v_tҡ0 DPuO50 AB<v_tFut=uډ)tWVh|Qv^|$4u D$@PD$,Ã0 @0 SFÃVWS>==|$4tD$@TPD$C$ Ck=3 t& T tT u$T  t j軭P't&j Ã{kC [^_] ÉST$ 0 @0 Ӆt"jsS Pu0P[Ív D$PP@P[t@ uj=p1@1 ÍvVSt$ W t*Vs0tj=sh1@u׃Vr[^ÐWVS1T ρU s%t&Bt@uU rۃP,ƉU s,&tBtBuU r[^_ÃWVST U shtUCu,Cus<<Cu)S*<ts CcދuU rt[^_Ð j j hW 1 ÍvWVS\$$8ru5W h p|$ ~{uw4U 4U tut&j=S/ƃu$SSPt xFWVS4U 4U ut&jW31[^_Ív =W uhLP4U 4U u1 Ív UWVS|$ 0 @0 jt ƃ?-u=u7jZ 3 3 BABAB A N 1WŃWU uRj=W\.tjW Pt&jjW]F F 3ujrrhwJv1 É UWVS111fuhuۅu u4U ;t,t 3qt3 Ń;uԉ[^_] ÉWVSt$ VVPNjtvCtk0 @0 j=s+xtjhW VsC$ Cu"uss7Sc7I1[^_ÉT$ Bt<=u%)))T ÍvS\$T$ C=t B8t;=u zu1[ÃUWVSD$P|$0W uD$0D$T U sy]taD$4#C;D$8tNj=s*x+sWǃ WsVD$0PD$HPh3 W1uU r[^_]ÐVS\$ t$$t&;tVpt[^à WVSj/ÃD$P4L$8L$(D$(\$(D$(șɉƹ׍>)$Pt$@t$4D$4׍>)$Pt$Ht$@D$@׍>)$Pt$Pt$LD$Lэ )$Ph21P[^_ É WVSD$0|$41j=w)Ãuwh1vCD$PS%ƃ|$ }:h.|$ u hB Swh8k1RVhOj \$S2jSPw &~ hS[^_ Ð UWVSt$ \$$~C8-u3Ń~?3ǃUƃ 9~W3.)P/u).U+1[^_] ÐUWVS\$0l$4D$u\50 1PEƿcu50 xvPuD$KD$[^_]ÐS\$ T$$X uBPrS4tS(1v[ÉU WVS]u 1ERu9heVS"-١0 9~J~Et>j EPR72X 0 ;EuYPX F&5 2>jhhjjW0 4X tѡ0 P0 9|1e[^_ÐVSt$ \$$CPt$4u hhsV+)tV&1[^ÐUWVSu} E16&w$E& t&hwWV+u 0 0 9~6~1t*EPRu-0 4h~5 <0 -0 4hPhPjjEP4 tC9|1e[^_ÐS\$ X uD$(@P5X S ЃtSM%1[UWVS}u E1E3vRt htt&E& dt&h,VWI*t  (0 9j.Ph#Ãuj:0 4M#Ãt3Cj EPS/X ;]uSX  X j EP0 4.X 0 ;EuVP X C5 AjhhjjEP0 4 tΡ0 P0 9|1e[^_ÃVS\$ t$$~F8-uK60uh@)t6h`$K~VS))hK#ÃujSS(ShVS\$$|$ uC8-uCvhƃs,à ShVV:-t hjShVV-t hG1[^Ð hx*1 ÐVSt$ D$D$ tu:\$ ShTj,CftPCPuhj"X u h 5X j![^à  t0hX j50 4!P" $  tj $ 5. ! ÐS\$ PY HY u P"t\BFE\]ÃUR9]=V;=\ t W&TY +DY [^_Ð D$~Pho#j hXK# t$  ÐSHY ;LY t@PY PRP( LY .j HY )Pa[Ð =HY ~jB É HY ;LY }PY DP@ ÐVSL$ DY C  9   9~L  |$$t?5HY ؙÃLY )P؋@Y 9}P5. < [^ÍvSDY  ujw    un&XY P4Ãt"3 s  !\Y J"`Y    hx [ËT$=XY uBIu(B9\Y uB@uB9`Y uBuBt1à UWVSl$ |$$u&h\ƃtt <:u~u1Gj:SXÃtC;uWES‹E E)Gj:SÃtE)C;ủ[^_] ÉWVS\$ 1SEP[ƃ ;t*Phat7\G7CG;u7[^_É UWVS$ D$,$ D$$T$4T$T$0j/V D$Dzu$ QD$teuD$4|$4tED$44( )$<<SPR"D$HtHSVP E$<<21퍄$<$<T$8T$(D$$D$ $<L$ <`}4<tt&<`tZG<u\$ @ )$<SRPWT$0DLT$HSPR@ uv4@ ))SPL$0QD4LSP\$DS1 sD$(D$$D$ MD$(D$$D$ ED$ <1D$01퍄$<$<tn1(uF t&{uGD$0<@ )$<SRPlDu9)&|$4u$P<cuD$4<dtD$4 t&E<u1tvE$<<uMxe$<4 tt |t&u7<@ )SPRsD     Si5. j\$7Sjq ~zD$H~@$t&D$5HY vjELY D$]=LY uD$fv:?*K D$$PHY (HY LY hXvHY hLY )PjD$t8Pt1:)&D$t@tPD$ t&jBHY 5PUHY LY )‰УLY P5@Y bjSjD$<[t$%=@u+u'V0 tt<}zD$p0 $HD$9}Zt&t聳P$t`ǃ VWtݣ}D$WM C;\$|D$[^_]ÐUWVS0 D$111D$u0wh$`j?D$(Jt& @;0+h50 D$, t&{hT$hnuVÃuh5. OSYu 1;j EPSNjE8u}h3vtOhnVeÃtRSu@j EPSËE8u} hЩuK9u}t h誩 P P5 N‰  |\hlEPE u h9h0jP5 e[^_Ív UWVSl$ jUP1;5 sU& U9s-<;u+P];XC Dt9~F;5 rj 0W' [^_] UWVSEEE EffE Puu =  ujuP1;= } EPEPEE}t9]|܃}t@9]u;<3u5}~ P5. EPh3XECUt Dt9~G;= s[j V e[^_ÐVSt$$= u  £  9 sd 9r[9sHP   Lt@9~B ; s$ã 9r 9rt$,Q[^ÃWVS|$ 1[Sǜ B<w S&%fu#=  uVS SFSWάÃu[^_É UWVSl$$vPwn$`= t h躥 50 950 zv h@}0   hUD$,Pl uh5t&[8Éa|$fL$f fL$l$|$ D$ T$l$1҉D$ T$l$ $à $h ÉVSt$ D$ uhD$PV9t$ t$v>؃=t V3t;uVh;؛C[^ÐVSt$ 1ۋ 0 DA t BDA u:t!DA utBDA uu[^ÉSD$ 1ۉD$ CD$Pu[ÃVSt$ \$$nD$ Kt$ V~+ÃD$PA‹D$D$R Ku׃V50 觡ƃu$C8-uOsXNjB1[^ÐUWVS$D$DD$@D$<D$8D$4D$0D$,D$(D$$D$ D$D$D$9D$@ $xj3huhPPD$8j3hu!hPPީD$4j3hguhPP襩D$0Nj3h0u!hPPnD$,j3huD$j3huD$t&j3h3jVhu D$@bjVhcuD$D>&jVh8u D$<Ph)t<,lFft&蛅OD$4Pƃ|$t*jD$$PaŃ}D$ Ph躨1D$ |$A|$ u |$@tAhPD$ Pǃ}D$Ph_v|$ tn|$@tgD$(D$0PW}MD$HPWj |D$X%=t=@uD$PhD$|$t4jD$$D$0PUG}D$ Ph貧|$ t.jD$(D$0PW }D$Phw|$$|$<tD$,PjVaD$,PVUGÃ}4|$<t\$(D$ PhD$ Pht|;\$(uD$8D$4|$DtD$,)Pj3P\$8SVW蘚Ã}D$Ph試;\$(uD$0D$,D$8D$4;D$$D$4PD$uC4;V:C9|ʃ t j #1[^_] Ð UWVS0 D$-. $0 Fh$< RpD$$u $$8 P|$,WRWټ>. ~hӎvj\$$S K3L$(1  F%))ъ>D7 hhWà qhSSŃKS-W<& ul$4 uD$0 t:D$,PD$0P U|q$4 DŽ$4  $4 u\$0 tRD$,P]T$0R |U}j7_1Xv$4 u DŽ$4 $4 uUj NUj @+vUV.D$ PNƃtW> t8 u&$4 uUj Uj UVT$ Rƃu$0 D$ P |U}!j D$$8 R\$,S} $4 PShל1[^_] ÃWVS|$ t$$dۀuu$&dtuu*yhVWu9=0 }+0 9}/S40 }Sj[^_Ð t$5 jD$$ P>PhH Ð = ut$t$ ÐVS\$ t$K 4))Љ)‹\ t*9Ju9BuC9B utu1[^à UWVSl$ |$$M 4))؉)ÅtW1P诶ƋE FEUFV tWFPOF\ 4[^_] É UWVS16\ <.tt&.PJ.uOy[^_] ÉlUWVS\$S$Pjt#$Ph .1t&= uD$T$  #= tD$9 u^D$9 uR D$LD$D$(%=uD$=@$PŃu  1j/$PÃt]X ƿtBƿt/P$P~ÃSD$4 SUuU7$PD$0P\ Ѓ av|$,vW= uNjSt.D$= u+$Pj\ &jS%  D$[^_]lÃUWVSl$0|$4D$\ bwU$\ 8G 9t& )t& t&  t&thWUtu0 9|hFuHD$>Ã4(ƃjj4迏 u4V\C9|ċD$[^_]ÐUWVSEh?)ԉl pUM~E @8-u st&jhtE}h~ږ jEPjHNyCCCCCCC C C 1jPj8F~1<u{EvEEE}WhFKEP}.EPWEP-0Ph jEPjE}~FrEP1e[^_ÐVS$$50 ÃF8-u"rjP Ã}pv5 g$x$x$x$x$zP$|P$PD$dPD$dPD$HPt$HD$HPhW@hD$PSu1[^ĔÐUWVSD$D$|$0Ol$4dX1xt#vPhVtPF<u;tD|$t7L$t-;u1[^_]ÐS|$ u h 8D$$a  áa 8t h2;ush?A&sSPS\$ jNX[ÐVS\$ j)SF [^ÉS\$ ;usS[ÃWVT$ t t8z+t&1r>tCu q^_ÍvVSt$ >u)jhÃvhES^ [^ÍvVSt$ tt JHvFu 1:t&PÃv^ &[^Ð a 8tt$01 ÉVSt$ \$$>t;u-VS svC9F[^ÉVSt$ \$$>t;u-VS svj C9F[^ÉVSt$ \$$>t;u-VTSK sv C9F[^ÉVSt$ \$$>t;u-VS sv C9F[^ÉVSt$ \$$>t;u-VS svb C9F[^ÉVSt$ \$$>t;u-VLSC sv  C9F[^ÉVS\$ t$$S>tV.u hH|FC[^ÉVS\$ t$$StVuhH|F[)É[^ÃVS\$ t$$StVuhH6|CF[^ÍvVSt$ \$$VZtSJuhH{Ku h]{VЙ[^ÃVSt$ \$$VtSuhH{Ku h]l{VЙ[^ÃV5 vwy@P:à w@9CuCWiV`؃ h$}a jc\ƃWU t/VtwNU9 ~~hÃEjģvEGHPF@P衣P‰SF WxUo Vc؃ t&[^_] ÍvWVSu5a dƃVS<ǃS V h++u[^_ÍvWVSǃh-t At&h/t "t&h1uHta 'ƃVWӉÃW[ VOSǃ et&[^_ÐWVSAÃh3Jt,h5/uHta ƃVS׉ǃS VW^à 댍&[^_ÐWVSeǃh7t h9t th<~uh>jt]hAOt $Bt&hD/t |"t&hGuYa ÃW|Ss SW։ƃW SV)ǃ [^_ÃVS]a ÃVwuSgt#V+S" j ShI,u[^ÐVSn>a \ƃStSt&VhKu[^Ð hr1 ÍvL$T$~B~AB~AB ~A B~AÍv(S\$0{dtN؋Cd1҉D$T$l$pChClCxD$T$l$CCpCtC|D$T$l$x|$fT$f fT$l$\$D$l$Ps3hIss ss3h.0s|sxstspslshsdh ${`tPh*sDsHs8s FVT@n RFPh N Ph7 v hDFPhQ϶ 5 hf蹶[^à UWVS|$ t @n 9v1m&  l <@r rnWh>hN, = t8jht,@r  t& E%f=@u mf=u  _f= u  Pf=`u  @f=u  0f=t(f=t"EPhe   u"h9   [^_] É  t%f=@thU ÉWVS\$ |$$WSƃtT <tEh 说.h蝴 jhJct f1u 1t&@n C)‹ Dr BrfVhP5hc# jh{t-C)ZDr ك   u  [^_ÃWVST$ D$$D$ PRǃtJha Wa D$PV~Ky|$ tha WT[^_ÉWVST$ D$$D$ PR4ǃtJhe Wme D$PV2Ky|$ the W[^_ÉWVS\$ @n 9wz <wo |%f=@t f=tf=uI1ۍwt&h VrCvh GPh GP [^_ÉUWVSD$< Pt$<Ãhi S]D$T%i ED$<@n  9D$v^Mh輱U5 h許 jhntfEhi SD$ 5 U 4螴 D$(P  |$4u:t+h D$4; u:tDh 賰  5 U 4̳ = tR= tC PPD$$PhDI%f=@u hR hWD$(PKt%f=@uD$(P  [^_]ÃVSD$  t%f=@thU  9Fshd膯 1;^sSVH ;^r[^ÁS$  jS5m b9th}hD$P5m 胳=[Ð UWVSf=@n  t&@r rT fxtE= tttt&'u'A\A'A'P= uE!u'A\A!A'1 u \An#0 DP t'A\AA'AF>u'A [^ÍvUWVS|$4l$8t$j D$$P50 蜜‰ D$,8tPh>vj D$$P50 c‰  D$,8tht>t&jRak  +hUD$j 0*s Ð UWVSl$ |$$15. SmSq F9}WÃu1[^_] ÐUWVSt$0\$4 D$#nu50 pŃhdSVlɡ0 <u50 U?1t&Nt$9D$0 ֿgu50 i$t&hxRN?ƃuD$|$t0 4hznVUVOd t 0 4h{#D$(D$90 } j "g;50 t Vn0 P0 | D$[^_]Ð oPhnm1 ÐVS$ $$u?S?PSf }rf8u hh"hSR?ƃ|$#tSjSp Vh\$Sju[^É UWVS$ $$11ۅ-vP-w$0  t&hUViŅht$VSmV"Zà j.3bfu 3)su tVdutPR\fi%C0CfPhk C8uԃhkPt jSt&0 9}jt"t&h\$SflSe 1[^_] Ð,UWVS|$@t$DD$11D$;nt&gt#rtuuE D$C&D$ t&hVWg|$t t0 uNtjPD$0P7k-oPD$0P:lPD$4P 4jP\$0SxmD$<S" PD$$Pt$0Vǃ\$4SB t|$tVW |$t(|$tSId'PhiSPVWhi 1[^_],ÐUWVSD$ D$$$H~"u u' H1҅tUR>SjjjlD$4} h ju$P"u]D$;-uCD$*D$(=t:D$00S5`uT$(R T$u,D$ (D$(L$(9uD$,(D$(@D$aD$0tT$(RT$D$(-$D$,D$$ t dt&}uL$tId$@ D$$ D$D$txhu\$D$?D$4D$,% D$,D$$D$(D$0;SjVv\ [^TÐTVS D$P`th? 7t$DuuKuuT$ D$0[^TÉPWVS11hZ ZtPh_ jh chg xZtj Ph Ut&D$PhTjdut$ho jh HcMD$LPhVjduD$HPh{ jh cj h h hh cÃ}cuj h h Ít&uj h h o렐}j h h TvD$PhTjcuep d h l  ƿ  uj h Ph jgSXh h jD[^_PÉ UWVSl$ |$$\$(7/3ƃVj7@c FPS7b~!42Pj4cF 9[^_] Ãl=[D$Ph jU\u)h !Zh. Z =h@ jbIlÉUWVS|$( 1. 8t&D$l$(|$(tO1j=\$44V‰T$0)RP. 4] t D$<uD$|(u. T$DDF. <v$S^`jS\ t$pVSjp]VÃjh"Tj-ajcV jVVjLV jVj]Yjj V jj VjjV jjqVjjeV jjVVjjJV jj;Vh$W(à }O$hPWj$ZtWh/ jYj`WhM j?j`j$OjhTS_S` S`MUÃ}he jj`v jjDUjj8U jj)UjjU j|$,WSYƃ9t}V8 uكVVS9t j_TÅ}hr j"jl_t&uWjhTV^jE_jWS9Y9t}U8 u߃j_S_S_ h $SWtlDŽ$l DŽ$p  $l f$phS$x$~P$DŽ$a&hS$xSv\$01:t $lFh D$,PUXƒuՍ$l$l;-u^CSD$0P-PU$0uh j~$|-t$(@P_$tLWQPSh j9 j.h 5. "RPQ50 ^ S$PbQPh j D$,P$tPSSS0]SPSh@ j0j\jVjX؃[^_]ļÐSt$,Ã&D$P^~9u9u[ÍvWVS|$ ` te9uOtSt&tSS6 t&t;uS~u[^_ÁS\$SZjSW jSWj SV j SVjSV jSVjSV jSVjSV jSj1WhͫTR h jm]h j jj\jEV =]h jj j[ jVj@g ]t H= wjj\\[ĘÉVS` }kSh$ j:jSSN JQ. Sh; jm\jcU h##Qu[^Ív [ =d uU Ph j \jU |$ u=t ~ h!Ch#PU Ð h jM[jT hgE#bP É j  ÃS'P v#U= t O[ Ð UWVSl$ \$(;u =d u,h SMt޿  ޿  u h jWƃuh j0` tut5` ht$,FPOhSP4 [^_] Ív D$1ɋ`  vыt-9uu `  RBW ÍvUWVSh  h  XD$,?h h j ah h& j@M h h8 j@6h hI h h hT jd tPhT jh tPhT jl tPhT jh h] jt&D$$ C< t< t<#2< *j SStV$,D$ P~Xj:SJ x@j:PIƃ~Fj:VIǃ}Gd =d tdVuJuH;t+ D$  fD$$hS\$,S0ISWuhD$(}u|$tD$Phm jD$ Ph$,VO[^_]ÉUWVSl$0\$4~ps u\h /t8&h t8 h j0yUjoS&Ht&h 5Y kOu &h`jIh,aj I h,aj xIhajiI hajWIh4bjHI haj6Ihaj'I jJ]t jH jHjH j h @N Kh ;J5 h j FCƿ t&ƿ tƿ uqd tPhT jh tPhT jl tPhT jh hT j t&h SUj jj =` uh jjj j?MD$8P"Tƃ ~ɋ` t&93uVCPh  ju뎐WVS|$ t$(>u1\WEÃS% VP`Fu&SQhWh`  SP1[^_É hǀ Ív j8 à j(@ @$ ÉUWVST$4l$<\$DL$@J,z NjT$01tp D$T$@B҃ $ )t&T$0B4uh h7h h F)1t&uh hIh h [FvE$u E$T$0P,E E Huh hbh h F)J%Ph LD$,D$[^_]ÉUWVS|$0D$1f0t&O8D${ CB s,C$0R,T$I,L$9sVvVL$u6tD$ AW8@(PW@$u H$h 9rD$G09D$[t]h W=ÃtUS1Ujh W.Ãuh! hh h1 D[^_]ÐÉVS\$ S*މÃ1Ʌt)t&F ʁt 1!Ku܉[^ÃUWVSD$@PT$@BPЉ%  )NjL$LL$,D$LD$+t$@\7T$uC;|$p<; u#;RL$$QjTD$,;C9pvWVS|$ t$$vnu 1 &軳ho VWՃu jjl} hq  |$u D$@8-u Ut&PPhx  1 à UWVSl$ |$$u 1W\ÃUQDPƃ0uUWV%\$(t jjjjVCuBu>UFÃh V SPV S"D$(t VD$(t VU VUtVv1[^_] ÉUWVSl$0|$4D$1:t&nt  ft"su 軱h WUu]0 9~蓱v9u/V4P0 4<uD$0 9}7t&Vt4uD$0 P0 9|̓D$(Px S|$ ~D$$@8-u t&jh Ã} h 750 S0t h jh S1[ÉpWVS$$V$(PRjt h D$P$ SV Ѕ$(%=$Dt]jjVeu%88u h .h@ VjhSth |$t'ShjKW"h jjVu.8uh wjh \$ SVЅ$(%=$DtajjVIu)8uh& h@ vVjhSt h ShAKWt h 1h w[^_pÐUWVS}Džuh hh h E &fIyE fHA~􍝀SjSL RSjh vh, SÃty;#tth, jƃtLjSÃw4PVh}= U fZt&Dž>t&EPhSMUR)&jPj[^_Ív UWVS$ $$HKyxh, SÃt`;#t[h0 jmƃt "Á|1ۍt&]E_fEEPhGKEPC~Fy1e[^_ÐVSt$ 0 DPtV9C4t&\$$;t!&3V=tԃ;u[^ÍvWVS\$ ފvCt9<.u;t0h" V_ǃ}VhS .Ch! S0}Vhm ۵ [^_ÐUWVS$D$ 1ۃPt$,VJZt&st ptBtt"9 9t&50  D$,h50 Vˢh $PU D$ PSD$,P9-0 uk1&4F50 BÃt tvӅ~!$Ph D$(P ut&jj{Ë50 9}N$4F|8WSà $4S@h S2 F9|SDSh D$8PY 11[^_]ĜÐS|$ ~`P\$Sm|$tS 1vh 蓳v[ÐUWVSt$0|$4110dtot j50 Ãˠh WV D$,utu0 B9u90 B9t 臠&D$PSt4~t&4[^_]ÐS\$ = uCPsj CPsj t;sh D s S1[É f= tj f  ÐS\$ 8u '%=u It  [ÐT$%=u It  ÐT$ u1 t%=u It*Ð   ÉSf= t;  )Årt&j f s f f [ÍvWVST$1ۋB%=@u)ƿ tƿ tC[^_ÐVSt$ \$t1$119}@%=@uAB9|[^Ív UWVSl$ |$$t 1(t&119}tDtFC9|[^_] ÐT$u11z`t @R`z`u@Ív D$~jPt&1 ÉWVS|$ t>7t,t&Ft PH ^`V9 ރu؃W' [^_Ð UWVSl$ t|$$1&|$(uD$,PU&T$,RU|$(uT$$)‰ЃP11ۃ;t$$}]|$(uTB%=@u<6|$(utt DTB%=@tCF;t$$|[^_] ÐVSt$ L$$1ۡ u A4V4)_u A@V@)Pu APVP)Au AHVH)2 u+F%=@ЋA%=@u J1҅~}u#16ƒ~}= uۉ[^É UWVS|$ tn|$$~gD$$t$$R;t$$}ED$ L$ )x<D$(44E;l$$|[^_] ÃUWVSl$4|$0KCf 19}CT$<0 tt 9}f G9|f= t  HЙf  w r~ 9}C9~D$9\$}xD$D$9t$}OD$t&|$|$  t|$|$9}T$<4\$D$9t$|t$D$9\$|[^_]Ív UWVS|$ |$$1;l$$& tT$(ph T$,pǃWLà ~pSWSW  tDjSWƃSWà ~#SVLSV2 VW"E;l$$<[^_] ÃUWVS|$0,D$D$D$t$DPt$XPh  Sh = th SU f S $|$tD$'Ph yf E01[^_]| ÃUWVSt$0D$D$      \$ShT5. vPMD$(fv f CftHf D$5. .PH  σG($    t&  ~t& nt&  \  G  ; .t&   0t& t& t& t&    t&  &  d X L50 f 1&50 f & h D$-u~u 0 "hX VÃu ut$,St,VhZ ^;0 tʃS뼐t&;0 t)SuVhZ 1[^Ív< UWVSD$$D$ D$$P 8-uxu 50 .hX $\ RƃuD$v|$0#]B< uD$,PD$,PRSu%L$(9tKt&0 DPtA9u/= D$P$X Rh` D$$$8 D$Pt$8t'D$= t$4h t&1ɋT$(T$-. D$HD$ 89DuT$DJڃ:9TuAvtD$ = u2 t Pt$4h 5.  VGu=Vu-D$Vh\$-u(~u"1ۃ+Ph! Cvj Vuj\Vt j\1ۍt&+Ph! &Cvj s|$tj*j X1O3< t<\t15. h3" )&5. h6" u 3PCV99rj 0 H 0 95. uh9" = t'50 uhE" Ԍt&|$t 1[^_],ÐUWVSt$0D$11\&mt pt;Dt&D$D$$P50 eu#50 h" K yh" D$SUzt &ލF9|΃jUTG[^_] ÉVSt$ jVÃ}Vh0# ݚD$Ph`S|SD$ S#D$SD$, [^ÐVS F $fFjj5 t h@# Phh 5 =thj# !jh5 =th# t&PV5 =t h# Ɉ^ S5 5 U9t h# 虈^ S5 5 %9t h# i  S5@! 5 9t h# 0[^ÉS\$ jS5 9t h$ ht$,5 =t h#$ ʇ[ÐWVSD! C=~h?$ 衇t ] H   F9s>F)‹= AF9s%F)B8r 9r hS$ 0f ] CD! [^_VS1;5D! }5u  )ЍX كF;5D! |[^VS\$ u  XC )F)‹  Bst&CF9r1[^ÉUWVS@! k D$D$=  E jEfC   EjH1 t&EfpS,ÃF~$D$T$fU$ L$11vD$fpSÃF~D$T$fUL$ L$11$(UD$(P3D$,T$ fr11f\}SWÃt"G~F~h?$ v|$t$(PD$(P|$tD$(PT$$R[^_]ÉS@!  fCC jC= t   @ P CfAfCftVC h@ CP[ÐUWVS 1󫿠  fFfF =  tF  fFH! u  VUUU)ƒvf  fFfF1Ջ  L$VōXT) 9t5fFGFTōXڋD$) 9t~ˁ~h$ FfFfFF Po F PZ  F Ph5 F Ph5 ~ 'vV)ЍX ك GF9rԿf= t:t&}G5 )ø 2G 9v˃   P}‰@!   PjR  Ph$ CPh$  CST RCPh$ K Ph$  s h$ [^_]ÍvVSt$$j\$0 S5 9t h%  Vt$(5 Ã}1th@% ؅} [^Ð  9L! sDhjj] L! tPhi% 5.  ÉVSL! hjj  j R5 ‹ L!  9t hp% A V9v)˃QSh L! L! 9tEV9sh% &)ЍX ك L! FL! 98 ~ Ph%  uh% v[^ÐVSh" t$,辬CD$Ph% VO T$)‰ЍX ك Vt ~ Ph%  uh% [^ÃlUWVS1틜$$N:-q1ɅBzt&SUqt ލF9r׍G[^_] ÃVSt$ jVÃ}Vh' D$Ph`S|& } T$ ЙL$ S= D$SD$[^ÍvlUWVS$$1 =tPh& .v5 ٢ 5 jP;   :-tN=P! t= } jD$PRX! D$$8t[acP! MB_t|tg1[^_] ÐUWVSD$ D$\$(1$4Pua) ) D$(BCBCB fC $PSh) S h) SD$41W诞D$(H<8 u8D$|$u 1vj:WuD$$|j/W(ƃuvF\$ )CPŃSVU+ |$uj`D$0jNT$,B D$,L$)AAA l$E}D$\j/Sq0 KBu;\tj/UIƃt9s$0 BtvFBut&F)CPǃCPVWDT$}j荸u  t%Vh1 5. 虭Pu1KVWޫ}7B8uVW Wh1 k1[^_pÍvlUWVS$D$9t&ft it$t& $   $  KGh1 W$P-u0 B;$~ G;$uzD$Ptj}"K8t0 th1 4j1ۅtD$(%=@t%0 t4}lD$b0 $M9}P4}_P$t\Oƃ V4}D$VKC9|D$[^_]lÐU,!WVS]11DžHlt et)4pt +G-50 Jƃ0 Eh1 U RS菰t50 辪Pت t 90 u0 9tNEjjjÃ} h1 hfDžt=DžffjPS輲} h1 LhtlDžjSO}h1 hvPPSQƃ}h1 gvSߩp0 M 4@0 } tffjPSѴ}h1 qgt&tNjSDSK jj,jj jPPۧjA pڃp jjjWhک } h1 f1h PWdjƃ} h1 Jf9uu j4t&ujS؃VRPY}h2 e&GGSD$ ff%f É%  ӃPPPPh2 詯1 [ÍvWVSt$ 2 ~t2 Ph+2 t11>tO4Eu|th/2 A1|th;2 $CG<uh>2  1[^_ÃS\$ M2 |$$t@2 t 3PhZ2 Ӯs, h`2 趮[ÃT$D$PD$PD$PRh2 t$<褰T$ D$$ ‹D$( T$, ffЃÍvt$,D$jjD$(P< ÐL$9t0 DPu9.uA1øÍv(S\$4|$0~C8-u $@t&裭AD$QT$AD$AD$RjPIP h>2 耭sNtss蝮jP?1[(Ð UWVSl$ t$$1X?hr2 VUA塸0 <u:2?3Gz2 tx2 Ph{2 Ȭt;u0 0 9}4RÃt;h2 膬1[^_] ÐVSL$1ۋT$ 1~Ãu ÉҍÉ[^ÍvVSjj35x! h2  5! h2 5! h2 ׫ ! tPh3 轫! t'+! љPh3 茫5! tc!  x3 )SR5! ! 1)SR! )SQh@3  =! P趬UVS5 F%?)ĉ$D$fD$ ! fL$! ! fD$  jCP荫VS fC jh jVS5|! ӥ }h|3 `&9tVPh3 Nht jF! t9! } j蘮hT jj }e[^ÉD$ws$4 3 Í3 ø3 Ít&3 ø 4 Ít&4 ø%4 Ít&74 øI4 Ít&Y4 øm4 Ít&4 ø4 Ít&4 ÉUWVSj\$$SJD$@ 9D$4)T$4|$0G;! \! G S)‰ЉC} L$C@BGL$)L$)ȍ4[Q)ʍ2! ;! s! ;! v! oT$  2s!  ! T$21! GPD$Hp葢PL$vj4jעj #j j j j RX ÐS\$ ;t';\u S P%C;u[Ív UWVS\$$t$,l$0CPqǃSD$8PWԣ; D3c$x6 |$(}%}UUN}UtPUeK|$(}(}U |vUPVj}UPRUPVE|$(}+}U=$+U+$V}U$D$@PWx kU$VD$PPWU0HE5|$(}}U%UV&} UUVD$0PW W_[^_] ÃVS\$ 薘jD$PSPƃt$$S [^ÉVS\$ VjD$PS@ƃt$$SM [^É(S\$0D$$PSc\$ t$4SD$0 [(É ܗ8t&t$hH7 5.  D$8t   ÐWVS|$$jjt$,ƃt2D$,HPWV4Ã~;VN؃[^_ÍvVSt$ \$$CCC Shd7 Vqj Sƒ tho7 VƒCPhu7 R8C h7 VКƒtCPCPh7 R h7 aAh7 V蔚ƒtCPh7 Rɞ h7 &Ah7 VYƒtC Ph7 R莞[^ÐlUWVSD$D$D$Oh7 EŃuh7 @&\$ShT5. 荓PdCftHD$h7 ӛQ 0 DPjy Wh8 $8Vkh\$DSV t$TPS$d\$,SN|$ u$`h8 S Wh8 Vh(8 Vyƃ 1$lu$hPS$hh*8 A$tPRS$xhA8 à Gu 5. RV賞ƒt D$)9|ǃV֚u$TPhU8 Zj 譓UqlU 1[^_]lÐ 5 l tP肔1v Ð,UWVSl$@U̇ǃhd8 hh8 ƃ uhh8 NOjjj芝Ã} hm8 (OGD$$FfD$"fD$ jD$(PSI}Uht8 NjD$$PS褝tUh8 =S诐D$ffU|[^_],ÃUWVS|$0l$4"ptsu1۾1*h8 UWԕȡ0 9u *&tD$,t!D$(PT} h8 MtD$0P̘Pht8 ! 1[^_]Ð |$tA*D$ pQktPi1 Ð h8 =t8&h8 =t8 h8 ><j0* ÐUWVS\$4D$|$0)3 ǃ~}^W3ƃVjɘŃ WVjxuWUVh8 Vh9 lLD$,;uD$[^_]Ð h9 褖1 ÐUWVSD$10ftRt!"itrtv h9 D$vhjjV Vjj`\$Sjhu< S' t hz< +-VjVL…}B$)¹)щyA$)QV VD$$PV4à 5. PSPhu t$WV81 [^tÐWVS|$L$T$1< t]t&t"< ]uGB9t@B9u|^t2+t1# <\u <[t :u t&B< u[^_ÉUWVS|$0l$8t$@9~1D$//0 DBt"FDBuS迈E<$uEpul$|/ tD= ED=[^_]à UWVSL$$A0 DB t&ED DB uh< t V詁ǃ_ST‹D$@P( SVRX=/[^_] ÉWVS\$ |$$10 DPu?/uC PCPWSƃ<>,uCPCPF>PSƃ>uh= 'C>Ph= sytF{su>PSovCPh= ?yt0{u{t{cth= 1'>PS.{ru.{u{th> '>PSkƃ h:> &>[^_ÐWS\$ STSTPhJ> SrPS6} SjT;#uhQ> S}Ãl! B! BP5! R ! ! P|1 S! P! TRà  [_Ív UWVShU> t$,xSSSǃVSD8PSfRÃ0VS藀V. SbS|\uU7,ƃuSSx SU,Ãu[^_] Ív,UWVSD$L0T$P*L$T9D$(D$D8T$DL$(<\T 0 DPAL$(T$DD$.ffD$.D$:P躁D$0L$X9;T$ L$Hу'D$$;D|5u%_@SV!Q1D>T$@L$$D5EAL$$D$ T$H;L|D$(<&u|D$(T$D|\tmL$H L$D$H;H|5u%_@SVP1D>T$@L$D5EAL$D$H;H|@t&|5u%_@SVDP1D>T$DL$(D5ED$(D$DT$(<NL$L1D$P(T$T:[^_],ÃUWVSD$4D$D$D$D$jjjST$Lriu u 1L$<A PEOŃSP@D$< P'OD$$t$0jP茀T$4D$! G| tjjjt$4t r t |$D$! 7GD$X> ED$=! t7GD `&t&D$$P7G! Po Ń! GD `tD$$PPC ŃgG;! }! x@sJt$( u6t$(t5. ! 7Gt$xE 5. ! 7Gt$w7G|u|uJ5. t$gt&jjjt$4tq u5. ! t$tw ! 7GT~^;! uV5. t$@w?t$(shU> ! 7Gt(| t P/E ! GDu|t7|$u>t;! t$|t+jjjt$4t-p uD$ t&D$|$u G;=! =! uut$(3st$(zD$

UD$,P5u=! u$0 Du P0 0 tt> u50 eT;t$ }LhU> tzÃuth> ,SSw F;t$ |1[^_] ÐUWVS\$0l$4$)ƒu E t&h> !D$ vux|$(GjD$,PuduƉt$8D$4 8tuh> Jv D$|$wv h? WhMKD$Pxt$h#? nwVh@? A1[^_]Ð T$|$~B8-u 5t&rwPs t hh? t+1 Ð T$D$02Am ÉWVS|$ t$$7PwÃ6Dw)É؃ u67l[^_Ív,UWVSD$(1D$$BD$ D$Brtnt /ut(D$$B#D$ t&D$ +hn? D$LPT$LR ru50 T$Du 0 D$,Ihr? PFD$<2v]PT$4RED$8WD$H<݃ T$8RǃuF;50 t;t$@xD$$PjUT$4R^r|$ tLMv|$t9tD$04tktT$44dnNyFt&19}<|$ttD$04tDktT$44nF9|1[^_],ÐVS$$P$(t$ViVEá  ~D; }(&; |j tl = ~j Tl 5. Vp [^ÉUWVS1D$41D$(. vhjI $P$RoteatFt1MgtFD$43D$(D$4 t hI 0 t&1v$9 0 }1t|$(t hI uu|$(thJ tn\$ h\$,SrD$4}Sh5J I'j|$0WqtPjWq}"D$(Ph@J  'D$$D$ eJ |$t1\$|S|$0WutD$(Ph5J &t&u |$(ut3@   T$ RL$(QS\$@S 1(D$,D$0=0 |$$9Jt&D$D$T$$8-u@D$1? 1l$3|$$4gtIl$FT~̓|$|$tWT$$XPhtJ vD$xP|$ W? POD$,D$@띍10H 1ۍ&0H D$$4$H9D$uRhJ D$D$xPD$$4jָJ u=$H9D$uRhJ >D$D$xPD$$4jָJ uM$H9D$uRhJ D$D$ PT$(RjhDI L$($4#PzָJ tָJ ua$H9D$uRhJ ut&D$D$ PT$(RhDI L$$$4"Pjt&ָJ u0  D$$PT$,RjָJ u&e j$P \$|SR u D$0pD$$46 t2SL$$4jQD$<D$@$t&|$$4htJ %t&D$$9T$|$0\$xSjL$0Qtet\$(Sh5J !v|$8l$@U|$0WjptD$(Ph5J !މ<t1d$@|$,uމ<tT$(RhJ X1[^_]ĬÍvWVSt$ |$$\$(tFu 1zt&Sv7=? t=? uu C% C.=? u)tC% 0CC$ C=? u)t$?C $׉Ccc=? u CC=? uS =? ut K c v=? u.tC$ C `C% 0C#K=? uDt C$ C K'&C% 0C#߀c&=? t=? uB\$,F~Հ;u 1[^_],ÉWVS|$ 11ۍjWe;L u L F~׸[^_ÍvL$1҉;L uL B~1Ív UWVSl$ 1ɾ8H 4H D* Ny@ 1T? tUsC# t UseC#!ЉNy[^_] ËD$u L Í~w  vu ^ ?i M -=v+=w  D ^ ? . ^   ^@   Ð D$= ujP] vP\t5Y > ÃWVShL hL |[Ãu.hL  pL u 0pSTuσS^j_pWVS$5Y L u    $udA8auXD$PhL jY} hL PPxu8-t31 [^_pÐ |$~D$@8-u t&#b1 Ð WVS|$0fD$D$D$hA 5" ƃ|CfD$\$SjV]D$DPWV^fD$0 SjV\/t&h hM ƃ|D$4PWV^^V%T ;hM 5. =TD$DPW5. X 5. hT[^_ ÉUWVS}" =" t E%9At9t9Au! =! tE9Bt :t9Bu9tuEPhN jh" \P1hN jh" \ M Q.v!E x ux ux :u x :ux t)]SeXS[E@ t&M MAEE =" eN %?)ĉ" 1EPhN jS[Sa-F^M N QI-CjV5" Zu#5T8t݃5" 5. h N e=" uE Ph" h. MQhTN e[^_à haN j.h R j[ =" ~ h|N j.5" o^ Á,UWVS$@h+ljhWS'^D$L D$(9 D$0D$D$,D$/D$ 9D$sw-0 D$SD$ +D$ )Rj APWItD$$;|$$+L$)˃SD$()Pj?h Q D$8L|$Huq;t$D};D$H)P. PRYJD$T. )VT$8RP.O "D$ +D$DL$HQP5.  Ot$$|$ Vj D$,PL=. tT$$9T$D#)@PWD$4. {+D$$)Rj W&HÃu=. tL$$9L$DT$P)Љ)…~T$X))VWYh D$XD$(PT$<4ƃ}hQ [D$8|$L|$HuML$$9L$D}D$DD$$T$(RD$L. )Pj}h Q D$8|$Lu<|$Hu55. 5. j}h Q D$8. E;l$,Yt&L$LQJ1;l$,t&D$0<h \$XS4mƃ~d|$<u|$8u)|$,~"0 $l 4hQ xLVSjh SL$<4 ƃӅ}hQ D$8E;l$,I|$4D$([^_]L ÐLUWVSD$HD$DD$@Q D$@D$D$<1D$8D$4D$0D$,D$(D$$D$ D$$`$dB8-:PP- $lpCP?P$tZt&7$R |$,|$0D$(|$0|$(D$,&|$,l|$(aD$0mD$4`D$$SvD$ CvD$@8-t hQ  0 T$@PD$TPD$X0 T$XGhQ 50 hŃ4D$HhjjP`B D$`PD$PPPr?à uh@R vT$LRD$LPT$0RD$0PT$DRD$DPSD$< SA?|$4ut$XcT$TRG |$<tD$HPD|$u1 h`R [^_]LÐS\$ ss s?=ssAA jDD$CT$BRsjI [É (UWVS$ (p5. >>Ń$$(/$((!$,(rkÃS4 jjP4SH $$(BPhArvGŃhtS 1t&(v (t )P|$W$,(2t9sÃ$$(uASWU.9t1D?0>P$8(p5 1 A)ƅ\$$(u&$((uU<$<(R [^_] (ÃS\$ |$$t|$(u1jss3|St&1[ÐS\$ |$$t|$(u=ss @}s shS #1SV[ÐS\$ |$$t|$(uEss 5E}s shS 1ss sH[ÐS\$ |$$t|$(u K%= t=`t=uACS$ S(T$D$ T$RQPjF}DshT ,&=u)Qs5>}shT 1S'[ÉUWVS|$0t$41^;/u2FPVx/t= # uh@T  # jjGdPAFjjGlPAF jjGtPjAFjjG|PWAF jjP>AFjjD$4P$AD$<FV jjIP@F$jjQP@F( Cs\$)Cs;l$t1[^_]É UWVS|$ l$$tn1?tg8/uj UP>u?A;t1&9t{/u;/tj S4k>tC;uF<u1[^_] ÐWVSt$ |$$u)1ۃ>t t&jW4>tC<u1[^_ÍvlUWVSD$D$Al$LUVu*D$H8D$hgT FT$H:$D$DD$`wD$jjU|$u-D$jd5L jjUx TR$PGt#D$`0tgjjU:t$P$Pu#D$`0t)jjU$$AD$hP7ǃt$pePhT ?ƃ0t$X\$,S|$ ut$XhT  ShT F?ƃt$\S|$ ut$\hT  t&ShT  ?ƃD$`̓w!t$xt$xhT j#S@à +t$XhT j#S?ÃhT >F3~D$,P>t)7www G@PGlPhT m> t$PhT Y>$u0D$`1ut$lhT 2ut$lhT >hT >$u3$uL. $u. t$LhT P5$u$ut$T6D$`6$hU j/t$T*u$P$PUy$P$PU+^t&$P$PU_>t&$P$PUt&$P$PUu8D$.PhU V$Pj41 ht$xV$PÃ$P%4~h#U &|$uh@U 1Gt&>$P3D$X8u |$t h@U 1[^_]lÍvWVSt$ \$0|$4WjP  t/D$$T$(AQD$,A fYWAP@[^_ÉVSt$ t%tt&P=؃u[^SD$T$ L$\$t;X u;Pu;Hu[É4VSt$D\$t$HFPhDV S>S P 9~\$9~P9VSt$L;1[^4ÉUWVS$0$4$<D$|$ |$hjW9=jdSW= vj$P9vj$P$ vj$P jj $S v@j $PjhJV $=P5= v$5P7$)uRV $)VV $-v$UP$)uRV $)VV $-Elt#Ƅ$1jdP$P<6F%=uQ$DP Ãu1Ƅ$2jdS$PMjhW j2(=/ t/ ÉVS/ $ 1Ʌ~3<u ?vT$Au ut&|$4<%t <\\D$4T$4x$` Uj%(vhh` t$@VUD$%` t:t$Lv1ƃ|$Lw lj1Ɖ11Phj` t$t$@v0h` *D$%` tVt$Lvǃv ƃD$Lp1lj1481Í31Phj` t$LvPhj` U|$@w4h` {|$t"T$1t$ Ph` Sh` Evt$@v$h` .|$<_h )Rw h` t&T$uSv\$SVSVW5.  5.  D$<u%Po &ƒt RX u%PC 1[^_pÐWVS\$$t$ 8cu1諚PxuN~8-t舚hBuP3b }#u 8tM3hb 貽Pj3s t3hb 聽t&N1[^_ÐVS1t&f950 uph 50 j ƃfH0 P50 j0 9t5 hb jf0 0 0 ff0 С0 f =0 t0 <J=0 t&f9u!0 <-ѡ0 <0 0 ˈf0 f=0  h 50 j0 9t5 hb  f0 UWVS|$0t$4D$0119sG9\$st)7&0 ,&0 &0  &ەB:u1ҋL$ D$L$ B~T$4VPGtÃ=0 tSVÃL$4t,8u hb ʧUP0D$,PUSV 19}2L$B9|1;T$}*L$B;T$|1[^_]ÐVSt$  3 ZfB  B <3 fBD$$B@  D3 ffBffJf\# ffC<3 ffCfCBD$$BD$P Rjh,3 j5<3 5 3 5(3 UÃ0| ;<3 t<}h c S5<3 5@3 h c 5.  [^ÉUWVS$$D$@1D$<D$l1D$H&$d 50 X# hXc H3 t&50 f\# fhlc 胥v50 D$Lwh}c ZL$@cv-0 X50 Rƃv=hc  50 *`# hc 胒vhGc WSi0 )Í<R5. j,3 03 43 83 7Cf,3 C s 0h03 @3 GtPZ<3 <3 =vhhc (<3 P 3 5<3 jP 3 03 BB 3 $ @ 3 f@ ̀fD3 hjj(3 }5x 艴‰$3 t$@tjD$|PjjR jh<3 jj5(3  }hc /vj\$|Sjj5(3  }hc vtjSjj5(3  thDŽ$DŽ$DŽ$DŽ$fDŽ$U‰$uUhc 肢 3 P 503 "P5@3 hd 5. { tUhd 5. `5<3 5X# h@d 5. AD$TnD$8D$41L$LQh`d -D$\;l$< \$l\$0S|$h|$0WD$\PD$dT$dR@ $3 D$0D$X |$p|$D$0؃L$t`# 1 1 t&h1 jj|$4WCPN ~.D$`P$Pjhh 1 5$3 D$P |$0D$0PT$\T$,R 1 B9D$0L$0)э 1  1 \$/!1 T$. ut|$/ucXP<B 9L{ uFD3 ff9u6D$Hf\# ff9Gu!|$/ t D$.@ &1 |$89$=d# tc=H3 uZd# j@h0 Ru3j.h0 ÃtCPh0  t&0 1ۃ=H3 uY$tOjj$Pǃt2j.7CÃth0 CP)u$ƒ=H3 t Rhc R؅uPhc >$D$8D$`T$T)‰ЉD$tL$(A\$$D$t{)ljD$tD$td $hed F$d t&=(1 whmd D$4aEhpd >t&Ehtd .t&D$4hxd Eh|d t&Ehd Z 1n|$0uhd 45. SD$LD$<9D$Lj d|$4u D$=l# u"jSƃtfSh9e ؚ=x# uB8u8jh!jWS*ƃ u ShUe  Shse dt 1 t&[^_ÃUWVSl$(Uhe SZukSu[ƃ>uShe 1:Syu*6hPj2SPShe 1 UÃj[^_]ÁVS$ $$g wB$e t# 4p# (vl# t&x#  t&ˆHxuJ~ 8-t=t# ut<P\$S6 uShe ةSKu 1&6he 譩[^ÐS$$L3 wq$Hf  L3 f L3 \& L3 L& L3 <& L3 ,& L3  &L3 ? &苅XxkI~ 8-t=L3 uL3 $S3uh(f 膨?f D$Cf D$ Sjj$aPjX $PjC$Pj1 $PjD$ Pj 1 [Ęà T$L3 t2"L3 L3  t Rt$hf # Ð T$D$L$=# t=|# t*u%=P3 tRPhf Q QR ÃUWVS\$40 D$=. 11Vdt'ctHut/A&P3 .t&# |# # |# hf SD$ ujJG=p3 jj5,4 D}E;[^_É,UWVSD$@D$1|$$|$ |$D$$D$(D$,؁|  =t3 u^4 : ut3 G&D$<~Z|$tjjRR64 S54 /t&=t3 u-|$ D$<~S54 {/w$l T$T$$D$% wD$$^@T$%D$&WFF j,4 P^&jh 5 yjr;vj,4 Rj j,4 P\F+v3  3 ~ S#{*3  3 ~ S5+<4 84 OjjjBaCj '< _DjuG3  3 ~ S*+fj,4 R t&jj*4=t3 uD$'PCt3 /6`4 3  3 ~ Sg)=Ë. 0 DP Ÿp6 {=ӡ. ӡ0 DPt7ßË6 D$ 9l4 b;p4 V4  t&' 54  74 (6*<ӡ. ӡ0 DP7 ßӡ4 6 t&p6 6 D$u5Phck Ut&j PMtE|$Pu:(|$pu>54 i&p4 B9u 4 v( |$pu't$$54 o44 t6 6 <54 %D$,54 %D$@ Pt$(1‰T$,t6 4R3D$<4  B3  3 ~ S4 @P{%D$'P A}t&4 D$ ;p4 sh8 D$(Phzk t$T$(PRW/D$,t4 T$ BD$ ;p4 sz uD$ 8  !t&:e4 3  3 ~ j; e4  4 ST$ 5p4 F9s.C< t'8t4ˍt&L$ QT$ F9s A< t8uT$ e4 8J D$ 4 < t&3  3 ~ S3&5  P5 5  L$L$$D$%WV:D$0Pu t$,] 6 t Pt$,6 ^3  3 ~ Ss4 BD$6 8?ueBT$Y3  3 ~ S/6 u k 8/u4 BT$8?u 4 IL$jV6 @Pt$('D$0t 4 j Ql4 D$u p4 HD$jV6 @Pt$(Z'D$0t4 k u l %l Wh7l >J jjh:l 54 'D$0% P" jjh:l 54 &D$0 P{"s |$0u=3 # t&3 DCУ3  h=l )8D$,PT 54 5l4 t"U7ÃPD$8PD$8P( jjt$(t$(-t$8!D$< t$,!D$0Pt$8"ǃ t&|$D$$PPz,CD$8 u";4 ||$>uj t$("&Ot$(!D$,wV!4 #._ &#"4 8 g@4 \3  3 ~ S3|$Bu|$Wt4 0 DP t(jVj54 )4 jVjP)4  |$WjVj54 )44 S4 jjPS+4  |$C|$Dj-`p4 J4 3 P 4 4 4 ,4 H93 ~3 3  3 j+ }t& !t3 h?l 3  3 ~ Sv p4 H4 9( 4 !4 P.u4 ,4 H93 ~3 3  3 j->4 4 1,4 J954 z4 F,4 J9|54 D$,x u' sj 54 #4 1j 54 "4 &t3 hLl :93  3 ~ S31|$Xu4 < t%|$XuH4 jj4 PP6)4 |$sd2ÀZtD$'PF8=x3 uE=5 u<=5 u3p4 HP5l4 5h4 5ơp4 +l4 9Xp3 I3  3 ~ S3|$bu 4 ; l4 p4 H9 4 0 DP t#jV|$#euPQ%4  4 0 Pu9_ujVjQg%~jVjQO%|$yt|$Yu1y|$Yt%1ÃVD$(PD$(P"u D$vVhZl tS|$cu2HD$ D$,P;+tD$ ;l4 vx uUjt$(t$( '4 Vh]l RtUjt$(t$(&4 Vhgl #tYUjt$(t$(&4 |$cu'j P‰4 p4 H9t.'|$du )D$j5|$cu'vl vl D$$BfD$(BD$*t&|$du}l }l D$$BfD$(BD$*|$yt|$Yul D$$l D$(p6 6 D$P‹D$,‰T$019w8 uFHL$9v^(Pp6 4ϞPVWhl 5 3  3 ~ SZ<4 84 T.á4 8 Tx3 Ct&.e4 j;4 e4 8ue4 q3  3 ~ Sl 4 0 Pu9_ujtjjjQ"4 p4 H4 9sB4  4 0 DP jjjQ!m-1.u,4 4-u 5,4 54 {4 jV' v3 HP54 c4 i3  3 ~ Sc 4 0 Pt . t. x3 p4 ;l4 uj Pll4 4 4 ;p4 tPA4 \$'S%0 DXu 3 54 `4 )ƃ: u~=t3 uJ4 [^_],É WVS$ $$ <.uC54 <'uBC. C<6 R5l4 h4 t#P"th4 hno , PpQj~ǃ|Mf|pPho w, $upRho R, t&pQƃh4 t P"5h4 􋅌P7'Pl4 p4 4 4  􋕌R'P5l4 QC' j 5l4 Džx3 t6 w'6 tPpt6 p6 w'6 tP?p6 1ۍv6 C~p4 HP5l4 ÃS=5 t =5 u o  t&j Pj }o P5h4 ho +0 vlPho Runu t hp  pQ蘓t.h4 t P?pPݷh4 [ *T lRh#p Qu1jj,4 HP_''9 6 lPh,p R:}'54  ƃ54  jj,4 HP&g'jh1p jF ;|<~v' ujh4p j >wjh7p j@jPjն~vX'F;v" lQh9p P&t&lRh>p Quq>3 0 /=x3 u&>p qu9p Ph`p (M qu23 B 0 9})ʍBPhp ' &n3 H90 hp 'vlPhp RpQ譐uhp Y'}54  ƃtVF ƃ=5 􋅌P9"PVR{"=5  D0PV^ ÃS=5 t =5 uo j PpQhp &04 9wУ4 x3 lPhp Rݿu@=x3 uthq '&Z 3 I 0 p3 AlPh0q R{DžlpQjj,4 HP%##h@q 7 =5 uhkq hnq =|3 uhkq hzq =5 uhkq ̻hq 輻=5 uhkq 裻hq 蓻54 hq 耻 h1p p jhkq pPBu Džlj hq plStjhq Sulƒ5 jhq plSƽtjhq S诽ul |3 j hq plSwtjhq S`ulƒ5 j hq plS(tjhq Sul 5 jhq plSټyPhq j=SdPۻE04 H974 ,jhq PkDžtB|PRxxPxQ谯ǃgu DžtVƃ}(54 ƃV5l4  } l;jj|RV1 ǃ~|QD8PW xPW\tuBxR赊8􋍀Q 9sxP荊48d􋕀RSƃll;2LlPhq R膺uh j h7l A!lQhq PMt&lRhq Q+pPt p=5 t =5 u$uQhq ? rPVË)@u DžRVQǃWSPh r 6 ;5l4 u p4 H9u;u x3 q;tlRhr Q}'54 ƃ54  5p6 PVTRVà Pp6 6 (PSh r =QP54 4  h`r X[^_Ð jhr j{ < t< uj Ð UWVSD$,PŃD$ ÍvS\$ p4 9r;l4 vXj1l4 9sÃj2[ÃVS\$ t$$x4 t P荱ƃ|4 P\x4 C~Kx4 ~Iux4 [^ÍvS\$ '(l4 t PCPl4 SjPUl4 Dt4 Ѓ [ÃWVS|$ t$$\$(SVW=5 tSVW8[^_É UWVS\$ t$(l$,D$0P輀ǃu>5p4 NuS~ƃ9s_WD$,PSjtC9rB@u95l4 uSƃ)9rWD$,PS&tK9s1[^_] ÃWVSt$ \$$u4j^VNj- )ÈFx3 YuJt3 3 ;`4 r f~ !l4 94 N (4 9up~ l4 94 NVVbƃ55 R 5 S8DS*D t& u PWƃ=5 t$Phr t W=5 t; u6VeÃPV%ƃCP; uډ[^_ÍvS\$$jt$,t x3 @[ÐUWVSD$8D$-4 Shr &tGU>lj;3 }VƃC;3 |V&ƃShr ʡtS54 t&ShZl 蚡t?S4 l4 9vH4 4 98 |H4 tShr Ft)54 uƃS =4 CShr t)54 ǃSL 54 D$D$08D$409s D$00D$48-4 D$[^_]ÃVST$ t$$D$( L$T$1ۃuѡ0 DP t uuL$1ѡ0 DP t uuL$0 B% ؃uL$0 B؃uL$1ѡ0 Pu_uD$,[^ÐUWVS\$0t$4|$8l$<vD$PWUSt$|$ uN~| p4 H9s ;l4 wƉ[^_]ÃUWVSD$4D$)[t) (t=)t%6{t]t(}t!]}( t&[{D$0-l4 =p4 9w9s:T$uC8uKut1[^_]ÉST$ PRCu j324 4 jj(Q4  j[ÉWVSt$ |$$~K7p4 )PVS9thr Wj V>=p4 x3 [^_ÉWVSL$ D$$P9sS)ȍxp4 )ы5l4 9ra9w]9rY9sU9s"QRSq9thr ]p4 )p4 9rZl4 9wp4 x3 [^_ÉVST$ t$$9vӉރ|$(Ӏ; t>CC9w{ uމӃ5p6 VS|$,uVSÃ[^Ð hs Ԡ ÐWVS|$ t$$fD$fD$j Vxat z~v5@4 W諥À>wh7p W营@\$D$PWx>~v5D4 Wa> uhht WKF>u[^_ÍvWS\$ 5 t P轧h vlj=5 1󫡈3 ~Ph!o 55 55 w¡5 5 [_Ðp6 5 Ív UWVS|$ \$$S\wƃVWǃ VSW1;t ; uEC;uPVUht 9[^_] ÃUWVS|$0D$49sƉ)CD$l$86 t V芦ScuƃSjVͦ D$ PWVK6 [^_]ðDp6 wp6 auDuUÉ D$4 ;6 r;6 vfP55 1tM6 6 4 6 PP6  54 P6  ÐS\$ 6 9l4 wbp4 H9wX6 6 6 ӃSCP=P76 0STPNPH6 0[ÐT$1 t uÉWVh4 j4 4 %4 %4 %4 4 (4 h4 jj芛 ^_Ð h4 jjl Ð h5 hTj}tf5 f5 Pf=5 w f5 f=5 w f5 P5 ,4 5 04  É hj辙jp 504 5,4 1jC à `4 j" h\jc jjTj*PԤ Ð jj,4 HPqh j jjjԗP~ ÍvS\$ hj͘hj辘 hj謘Sh 5 ^S\$ hj腘Sh 5 7vS\$ h$j]h$jN h$j t9t4(4 9uKD$Djh5u jju% t PD$P蔒% [^ ÍvdVS\$ptSmu &t&D$PSjs|t$4[^dà UWVSt$$|$(5 |$ tD$,Pmuhp u 1"t&} Wh@u l;5l4 r;5p4 vhu Q=5 tjD$,PÃ}AjD$,P訛Ã}hu D$(Phu 5 WVdƃWVS蟞Ń S}"D7PVD$8Phu '9}/)D0PD5PnD$8Phu  9| x3 [^_] ÐWVSD$ t$$\$(uhno GhhAP裚ǃ}')CSVW襐ƃ9t1W[^_Ð UWVS$ $$ \$1҉f}1,4 9|r}104 9|jEPFP5T4 S荜SQktPSj[^_] à 5L4 kP5L4 jΏ Ív 5P4 jP5P4 j袏 Ív 5@4 jP5@4 jv Ív 5D4 jP5D4 jJ ÍvS\$ jS, j~[É 5H4 0jP5H4 j Ív =|3 u j { à 5|4 j 5x4  ÃVS5`4 i11Ƀ9}5`4 2B9|~S9 h3 tK h3 jj,4 HPS5`4 j' /j584 544 [^ÃVSt$ \$$5@4 5`4 菛SV5`4  i`4 P 5D4 5`4 [^Ð D$Pt$5`4 貌 Ív S$( \$SShv O [ ÃVS54 5l4 Ãp4 HP5l4 ƃ ~t&11۸dPVSj Ѓ=x3 uv P=5 t =5 u o Ph4 u$v Ph@v  [^ÍvS\$ jjjS [ÍvUWVS|$0t$4l$81lD$<^vR|$ uC5D$ ~ uD$~p4 9l4 s 9sD$F|$ W[^_]Á UWVSjh84 h44 54 4 D$4D$< &h j |$,W蔖Ƅ$/ L$0QD$,PW p4 9T$sL$AL$< uD$104 D$I\$x4 $0 tl9+-<4 8D=ut&F9T58:tD$9|,-<4 T |$ vI9|T 8:tD$l3 9<4 tD$}1D$H9~9~1|$ug)GP<4 D(PSl3 9<4 tjVL$(Qt&jVD$(PdGPSj։D$,4 H9D$wj584 544 %<4 ;l3 tl3 [^_] ÐVSt$$|$ t[$jvFÃu vGj׏jh`v S7 ᐐS\$0,% tt$(hdv 覑,% tt$,hdv 艑,% tt$0hdv l,% tt$4hdv O;tShiv 9j 茊[ÃUWVS11D$11D$DD$w2$lv E9v1S؃)C|$tD$GCD$D$ct qt 0 Dž0 50 +]Ë)ڍBRhw !/50 Qc) @ @@ fPRhww M QEP赊 0 )E}tRM 4 w tw P~t%PPH[PK uk4 W tP[uw  W t9RQ,$t&􋅸P!4 W tu hw Z-x u. Dž,x tx PQZtV􋅘PPRjȅ} hx =~ Dž uvu*RQPh#x >,t􋕼R·Q t?;x t9x Ph@x P~ h_x R~hrx Q~t-hPRePhx Pw~ t7t-hPR%Phx R7~ tQhx P~wRQ˃hx P}RhV6u*QPRh y ]*t'0 DB uC;t DB tC0 DP uS+ǃtkt@dt;/,PQhVut,;. tPhx RG}Dži&UVQPR VS%Ph"y (h?y V蹅u Sy0% DžhNy V脅uVh`y SouDž4% +QPRShy _(hy Vu\;/uCPqU@QSSUPVuPPhVÃ+Fuhy TRWQjjf =t4PRQPhy #'vj:xÃtCWPhy =tU=KuWRShy =t1QPRPPhy &WQjhy WPjhy l WRhy Q=u!P8w0% DžWQjhy =t1PRQPhy %j,W|CP˂ƃ j,W[ÃCP譂ƃ VP%ƃtsRhz WrWQjWR =^t8;. tPhx RxDž ) 0% WPh z =~1RQPmPhz $=4% t*VhS3}jjSv~0%  uXjIRPjSƒ;thz 05t&8% У8% t)0% 0%  u6V=4% t=vPjSo=4% tJVhS_VhSP jjS}0% u 4% u!Vuth"z P4t&=4% .u jpu^tUV~SQjj =tPh5z "SPjhCz jVSt$ \$$jhHz V|uCP3C CvjhPz VX|uC3C t&VhWz B"j/3tt @Ct&hrz KOCj@3}ƒt CBCj:3st@P~C[^ÃSD$ W W CCC fW Pj‹Br 0hW |؃ [ÐVSt$ D$$ffFjjj}Ã} hsz 2jVS[} h|z 1hz Sru hz 1[^ÍvWVS\$ D$$t$(|$,VPSUytـ9 uA9 t9 u1. A0 Pu9-t߀9:tShz U t&A< t< tˊAt< t< u9tvVt u[^_ÍvVST$ D$$t$(\$,t"urz PRhz VrV8s VhSVxu hz 00 DPt΀{ uȃS|[^ÍvS\$ ShT5. )rP}tCPftЉP[ÐVStƋjH[^ÐD$ D$D$ D$T$ $T$jD$PjuÉUWVS$u\$@D$DPvDŽ$jSjuk j1$u'j8% 5. j %w [^_]Ð|UWVS$D$ D$~$B8-uOh{ slD$4uD$$| D$0PFÃT$$<:uD$ Kl$$$D$1VgvUFl C;\$ }I$0U&ƍD$8PVj puD$8@tVBnD$,|$uD$OeD$[^_]|Ð$VS\$0:xƃ~ V\$ S&|$tSm1Vh@| [^$ÐUWVS|$0uh`| DPjP-DŻ92D$@4dEt0VU6DŃ D$<4Uarhk| USr C9|D$(P D$8P E jUDÃD$4PDDPCǃUWq D$$PWqhm| Wlƃ u(ho| '5. SoS;t VWÃuӃViWt D$(Pt50 D$,1[^_]ÐWVSt$ |$$~ G8-uuhu| kuOt&9}&5. 4nt"F 9u RUjuhw| hC9|뗍&[^_ÐUWVSD$X|$4tD$hP =P tiX 1t5|  ÃSD$LPT$<҃ tj8tSh| %Sr <.u[^_]Ív L$Y 8-u@Y Y :tB~ 5. fD$,|$<~#;t#hC~ 5. hfD$,;uhF~ 5. Efj pv<% T$ ujWVÃ}"> ujWVÃ} 'SWuSM[^_ÃSD$ tP_Ãtxth CÃ}]h -Ã}Gh Ã}11ۃSuC~h M[ÐD$H8t:/t A9vЉB:u8/uAà UWVS111'PWU%ŃG9.F ttD$,PUJÃuՅt. &1[^_] ÐVSt$ \$S2Oth j1K‹D$$uh' D1uUt$QKh3 sNJPVk 0jKVS sKj UsJ|$uh5 hM t$I[^ÐUWVSL$8O D$U 1D$0d$4É utÃ1RPVSPÉeP ;t&D$Y Gځ}  w uvT r ~1PUVST$0Rjh0W dS0W  [^_]ÐWVS\$ t$(1ujXR#ƿ|$$uVSj-NvVSjOÃ|F%=@t1t VT[^_ÐVSD$POuhb 1:$1h PTPS‰41 Ky׉[^ĔÐVSt$ jVDRÃ}Vh 17jhLSHS}h \1SgH[^ÐUWVS$$8WUQƃ}?$:u3J8u1jUQƃ}Uh W$QbQÃ}(VG$Ph $ |$1#j@UD$@P $D$4D$<VhLSR }/h "S1G V%GmvD$PhLSQ}9jhLSQh  SFVFSFVF1 [^_]ĜÍvWVS1Wh $VR$PVjJun$%=`u[jVOÃ|GD$PhLSPt!H8uSFVeE SEGU1[^_ÐWVS|$ @ HW 1ɻ# t HW # t, &6 HW # t " 3CA~HW [^_ÃS\$ SCuSh^ :@[ÐVSt$ \$$S2GuShu VQ 0VMR[^ÐS\$ SNuSh| @[ÐVSt$ VNÃuVh &s Fus h ^@[^ÐVSt$ \$$SFuSh V

5TW (D$/t$. 1t th  t&5TW :(ǃtWh 5TW (D$ v5TW 'KyD$tB5TW 'ƃ5TW '1ۃ 9s5TW 'C9rD$t5TW 'uD$t5TW g'u}h /114u#fu 5 th h` w5TW jj\$ S,L$C SC  ѡdW 9th u<KC SC  ; hW th 5\W 25`W 2 [^_]ÍvS\$ jS3u h jjS,uh2 /5\W 25`W 2 [ÐVSt$ \$$5. '5Y hA 5. P' SV5. +[^ÃVS\$ (0uF t$,S;tG VH(PShJ 5. & [^ÐVSt$ t$,VF2ÃuVhP gz([^ÐS\$ S)ut5 F[ÍvS\$$St$,.ut5  [ÐVS\$ t$$VS50utt5 [^É D$u1P%u5  ÍvVSt$ \$$uhS vCSSVP [^ÉS\$ t$,S0uSh` "[ÍvW|$эA_Ð UWVSt$ &uUfƃ UVUV/Ãu>&ǃ?"tɅu.&NjV$/hc M1 [^_] ÐWVS|$ 11ۉPSVƃSVW"ƒ uW5Y hp 1B9|2[^_Ð UWVSl$ t$,t$,U|-ƃt2jjUV'ÃS5ǃ SWUV'Whv [^_] ÐUWVS|$0l$4t$8L$tJ%atFD$u5u5f} Uh  Uh WJ16t&tUv%P҅u@tD$& tv9Cu T$9S[uD$ff1ۃ|$t)jjD$(P$ÃtU3Wu"1uUv%PWjËFCFCF C & CD$(CW@PC0WsB/& UsW1[^_]É T$ftfuhh hW 5vht$$RhhW  u W 1 ÉWVS\$ X 1&PCh WE-FvX G[^_Ð D$ftfuj@h h@X #t&P| ÐL$t' =t' t9Ht :u1ËL$t' =t' t9Hu @,Ðt&:uÉ UWVSl$ =' }@' = ' jh "t ' t' =t' tcCtRt9uJC,u@u#=' u{0tjs0h"ujjs,C,|ǃ>u}h 5. [^_] ÉWVS|$ \$$tqBC:t 50 DNtbDFuXDFtK9v JDFuBR4)ƃS&)9~1 t&)[^_ÉWVS|$ 5X vtWFP:tC}hjÃjWCP uX st X v X [^_ÍvUWVSjƃ}Y& 0Ph@ 5. > jƃ} hg ~t&|$G\$SwGWhVc( |D$9u @Ǎt&_19}&S  ;t$|1w([^_]ÉWVSt$L$0 DB t ADB uthDB u^t&:u;ˉ:AF0 DPu9:tى9u1'AAFtӡ0 DP t[^_ÉST$ \$$& TPxPXP|PHP@P$P4PLPPPhPlPDP<PP,Ph Ra&PxPXP|PHP@P$P4PhPlPDP<PP,Ph R%xPXP|PHP@P$PhPlPDP<PPh R%ǃ,ǃ0ǃ4ǃ8ǃL@1[Ð,UWVS=X t1$@u X h= h? P&D$,u20Ph? h` 5.  6D$ Phl$" }C(C,C0C4D$ C(D$$C,D$(C0D$,C4UV$Vhp5' ! }C(C,C0C4D$ C(D$$C,D$(C0D$,C4UV2$VhB5' ~! }C$ D$ C$jǃUV#fD$0VhW*! GǃD$ C8D$$Cu;EPU@<=t <>tt&G(JU't&/uV)t&jÃVSƃ S$ t&:/u3 7$tCG%=GRP$P$P%G Y &$tUG%=G@PEË$PwjS8GG Y ؃ $&D$(PVjŃun$u G9D$h}#D$8%=@tIV;t&$u7h ٪w$P*$tSV ÃSJ jjPt$uh nS6O%=`w4= yw=l&=@=w=t&=%pGt9VP'T$Dw7h$ h@ VÃuw$PG Y RPS$P趧S% t&QV$VhB VwY}z$w7h` عuGW D$ T$$D$ PQVj\u,$A7h 荹*t&G%=t\$ tGD$T$BRVFwVww V w$P($tinvalid magic./ֻɻwn`qquietprofileunounsetbnotifyaallexportCnoclobberEemacsVvivverbosexxtracesstdinnnoexecmmonitoriinteractiveIignoreeoffnoglobeerrexit                xtmhaZSLGA<70( "}""{""while""until""then""in""if""for""fi""esac""else""elif""done""do""case""!"assignmentwordredirection"`"";;"")""(""|""||""&&""&"";"newlineend of fileNIFA<72/+(% }{whileuntiltheninifforfiesacelseelifdonedocase! %s PATH=/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/binIFS= T  T ,Q T ,G0T  `P@T  <PT  5`T  ,FOPTIND=1PS2=> PS1=\w \$ MAILPATH=MAIL=alias %s=%s alias%s: %s not found aunaliasAl0 |DuDke_DY1Q JFB$<608*%5 HFEvT97X2wait1unset2unalias2umask0ulimit0type2true1trap1times1shift0setvar1set1return5readonly2read4local2let2kill2jobs0help0hash2fg2fc2false5export1exit1exec1eval1continue0chdir2cd1builtin1break2bg6alias1:1.HOMEHOME not set.OLDPWDCDPATHcan't cd to %s..PWD%s:  z?  CHFtn(Oerror %dPipe call failed%s: not found command-p_%s is a special built-in 0P3 hFf   BusyBox v0.60.3 (2002.06.10-21:09+0000) Built-in shell (ash) Enter 'help' for a list of built-in commands. %s%s: %sCan't open %sOut of file descriptorsrvV%s is an alias for %s %s is a shell keyword is %s%sa shell builtina function %s() { %s }* Built-in commands: ------------------- %c%s builtinfunc%s not defined in %s%s: %s    vPATH6666missing CTLARI (shouldn't happen)divide by zerosyntax error: "%s" %dnull or %.*s: parameter %snot set@$ ````````@``Q``````````````Out of spacenot compiled with history supportPPIDsh: turning off NDELAY mode Usage: kill [-s sigspec | -signum | -sigspec] [pid | job]... or kill -l [exitstatus]ls:invalid signal number or name: %s0 invalid signal number or exit status: %sjob %s not created under job control%s: %mjob not created under job control[%d] %ld %ld Exit %dSignal %d (core dumped)%*c%s No current job%s: ambiguousNo such job: %s/dev/nullCannot forktcsetpgrp failed, errno=%dtcsetpgrp failed, errno=%d %d: %%%ld - core dumpedYou have stopped jobs. }-+?=; && || | ()if ; then ...while until ; do ; donefor in ...case () ...>>>>&>|<<&<><<...???&(0'''p'&'''(@(h(*( )0)p))@)`)P)w)))you have mailexeceval/etc/profile.profileENV Use "exit" to leave shell. %s: not foundp:rarg countIFSSu=%s,g=%s,o=%s %.4o Illegal number: %sIllegal mode: %s~tqfddVsEc6m l pnnofiles(descriptors)process(processes)locked memory(kbytes)memory(kbytes)coredump(blocks)stack(kbytes)data(kbytes)file(blocks)time(seconds)HSatfdsmcnplinternal error (%c)too many argumentsunlimitedbad number%-20s unlimited %lld error setting limit (%m)'> >D>T>T>T>>>`>>>>>`>>>>>>>>>>>>????????????@ @?0@0@c@c@c@c@c@P@P@c@c@@Current option settings onoff%-16s%s Illegal option -o %sBad -c optionIllegal option -%ccan't shift that manyNo arg for -%c optionBad for loop variableexpecting "in"cPcPcPcPcPcPPPcPPPPtPPPPNPPPPPPMKPPLL@PBad fd numberIllegal eof marker for << redirectionMissing '))'Unterminated quoted stringMissing '}'}-+?=Bad substitutionEOF in backquote substitutionY2YYZZ"[p\_[[[\Y\\%s unexpected (expecting %s)%s unexpected%s: %d: Syntax error: %s cannot create %s: %scannot open %s: %s%d: %mhhhii j j0j0jq1s1s1s1s1s1s1s1s1s1s1s1s1s1sq1s1s1s1s1s1s1sq1s1sqqqq1sqqtrap -- %s %s %s: bad trapwwwwwwwwwwwwwwwwwwwww%.*s: bad variable name%.*s: is read onlypNot in a functionList assignment not implementedvfA%s%s%.*s%s %dm%fs %dm%fs %dm%fs %dm%fs sh: let: syntax error: "%s" sh: let: syntax error: "%s=%s" %ldinvalid operand-Rinternal errorRrwxstunknown mode: %sRh/cannot change root directory to %sSHELL/bin/shcannot execute %sVV/dev/consoleVT_ACTIVATEVT_WAITACTIVE[%dD[%dA[%dC?%d2В@20@PATH `"#$%^&*()=+{}[]:;'|\<>. ./../%-14s 7`pШ R!-srEOF on %s %s %s differ: char %d, line %d adfipRrunable to stat `%s'idmuvtF:r./ @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@,-Help ntok is null for starting position! What do I do? invalid byte or field listmissing list of positionsb:c:d:f:nsonly one type of list may be specifiedthe delimiter must be a single characteryou must specify a list of bytes, characters, or fieldssuppressing non-delimited lines makes sense only when operating on fieldsa delimiter may be specified only when operating on fieldsr``Ƿ`ǷǷǷǷǷǷǷǷǷǷǷǷ%2d%2d%2d%2d%d%d:%d:%d%d:%d%d.%d-%d:%d:%d%d.%d-%d:%d%d.%d.%d-%d:%d:%d%d.%d.%d-%d:%dRs:ud:TZ=UTC0cannot set date%a, %_d %b %Y %H:%M:%S GMT%a, %_d %b %Y %H:%M:%S %z%a %b %e %H:%M:%S %Z %Y %f%Y.%m.%d-%H:%M:%Sstack overflowstack underflow%g 953$/$-P)P'#<\̿eornotoranddiv/mul*sub-add+%s: syntax error.@Bʚ;@GGDMMDkkDbwcbs=count=seek=skip=if=of=conv=notruncsyncnoerrorinvalid conversion `%s'%sstandard inputstandard output%ld+%ld records in %ld+%ld records out V/dev/consoleVT_DISALLOCATE0: illegal VT numberVT 1 cannot be deallocated%s/dev/root%-20s %9s %9s %9s %3ld%% %s Y@?1k-blockskhm Size1M-blocksMounted onUse%AvailableUsedFilesystem%-20s %-14s %s %s %s %s %s: can't find mount point.rcn:s:klogctlabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789rwunique name not foundw+unable to rename '%s' as '%s'C!du%s %s %s...slxhmk005 000000000FKbkeymap/dev/tty0Error opening /dev/tty0ioctl returned: %s, %s, %s, %xqq%d|%d|%s|%s|%s|%s|%d|%d|%ld|%ld|%ld|%x neE+iu:-%stoo few argumentssyntax error%d 0%dnon-numeric argumentdivision by zerowarning: unportable BRE: `%s': using `^' as the first character of a basic regular expression is not portable; it is being ignored%s()quotelengthmatchindexsubstr:*/%+-<<====!=>=>&|FF-n-double-laced-vsync-hsync-accel-t-g-i-a-db-fbmode reading not compiled in mode "%ux%u-%u" geometry %u %u %u %u %u timings %u %u %u %u %u %u %u truefalse accel %s rgba %u/%u,%u/%u,%u/%u,%u/%u endmode mB?/dev/fb0/etc/fb.modesfbset(open)fbset(ioctl)Unknown video mode `%s' %sinvalid argument `%s' to `-type'5 55555'555550-follow-print-nameoption `-name' requires an argument-typeoption `-type' requires an argument-permoption `-perm' requires an argumentinvalid argument `%s' to `-perm'-mtimeoption `-mtime' requires an argumentinvalid argument `%s' to `-mtime'-neweroption `-newer' requires an argumentfile %s not found.bufferssharedfreeusedtotal%6s%13s%13s%13s%13s%13s Mem:%6s%13ld%13ld%13ld%13ld%13ld Swap:%6s%13ld%13ld%13ld Total:cannot open %sfailed ioctl on %s@h$x$1.2 - 11/11/96 %s/%.*s/ %s (y/n)? %s (n/y)? y n r/etc/mtab%s is mounted. Do you really want to continuecheck aborted. Zone nr < FIRSTZONE in file `Zone nr >= ZONES in file `'.Remove blockRead error: unable to seek to block in file '' Read error: bad block in file 'Internal error: trying to write bad block Write request ignored seek failed in write_blockWrite error: bad block in file 'seek failed in write_super_blockunable to write super-blockUnable to write inode mapUnable to write zone mapUnable to write inodes..seek failedunable to read super blockbad magic number in super-blockOnly 1k blocks/zones supportedbad s_imap_blocks field in super-blockbad s_zmap_blocks field in super-blockUnable to read inode mapUnable to read zone mapUnable to read inodesWarning: Firstzone != Norm_firstzone %ld inodes %ld blocks Firstdatazone=%ld (%ld) Zonesize=%d Maxsize=%ld Filesystem state=%d namelen=%d Inode %d marked not used, but used for file 'Mark in use has mode %05o Warning: inode count too big. root inode isn't a directoryBlock has been used before. Now in file `ClearBlock %d in file `' is marked not in use.Correct contains a bad inode number for file '%.*s'. Remove.: bad directory: '.' isn't first : bad directory: '..' isn't second %6d %07o %3d : internal error: bad directory: size<32seek failed in bad_zoneInode %d mode not cleared.Inode %d not used, marked used in the bitmap.Inode %d used, marked unused in the bitmap.SetInode %d (mode = %07o), i_nlinks=%d, counted=%d.Set i_nlinks to countZone %d: marked in use, no file uses it.Unmarknot Zone %d: %sin use, counted=%d bad inode sizeneed terminal for interactive repairsunable to open device '%s'. %s, %s %s is clean, no check. Forcing filesystem check on %s. Filesystem on %s is dirty, needs checking. %6ld inodes used (%ld%%) %6ld zones used (%ld%%) %6d regular files %6d directories %6d character device files %6d block device files %6d links %6d symbolic links ------ %6d files ---------------------------- FILE SYSTEM HAS BEEN CHANGED ----------------------------        --%s %s -%c -- , empty long option after -l or --long argumentbashtcshshcshunknown shell after -s or --shell argumentnamealternativeunquotedtestshellquiet-outputquietlongoptionsoptions+ao:l:n:qQs:TuGETOPT_COMPATIBLE -- missing optstring argument-+@@#@@@@@@@@@@@@P@@@@@@@@@@@`@@@0--%s%c%i%c%s:1 %d regrepiHhlnqvsce:f:A:B:C:Einvalid context length argument-%sG,pP`zcatctfhdqv-q option not supported, ignored-r%s: Couldn't stat file %scompressed data not read from terminal. Use -f to force it.w/dev/null.gz.tgzInvalid extensionOK Couldnt remove %sf   p              u      cf123456789dq-compressed data not written to terminal. Use -f to force it..gzstdin%sstdout      block vanished-l used on binary fileinitlinuxrcno process killedn:-standard inputr==> %s <== %s%lx you must be root to change the hostnamesethostnamerdfisF:%s L L L L L L L L L L L L L L L L L L L L L L L L L L L L L LL LL L LL L L L L L L L L LLugrn%ld uid=%ld(%s) gid=%ld(%s) "Cqc$TG<q<q<q0SIOCSIFADDRSIOCSIFMAPSIOCSOUTFILLSIOCSKEEPALIVESIOCSIFHWADDRSIOCSIFBRDADDRSIOCSIFNETMASKSIOCSIFDSTADDRSIOCSIFTXQLENSIOCSIFMTUSIOCSIFMETRIC      3 S  C           } Ax Adownupdynamicallmultimulticastpromisctrailersarpirqio_addrmem_startoutfillkeepalivepointopointhwbroadcastnetmaskdstaddrtxqueuelenmtumetric-asocketdefaultetherinvalid hw-addr %s SIOCGIFFLAGSSIOCSIFFLAGSV        @ restartshutdownctrlaltdeloncewaitaskfirstrespawnsysinit/dev/tty2/dev/tty3/dev/tty4/dev/tty5/dev/consoleBummer, can't print: Error checking free memoryTERMTERM=%sCONSOLE/dev/ttyS%d/dev/tty%d/dev/tty1/dev/nullTERM=linuxTERM=vt102 serial console detected. Disabling virtual terminals. console=%s /etc/fstab/bin/mount -t proc proc /proc/sbin/swapon -a Sorry, your computer does not have enough memory. HOME=/PATH=/usr/bin:/bin:/usr/sbin:/sbinSHELL=/bin/shUSER=root t     Please press Enter to activate this console. device '%s' does not exist. Bummer, can't open %s Can't fork! Can't fork! ~`!$^&*()=|\{}[];"'<>?/bin/sh-cexec malloc failedWaiting for enter to start '%s' (pid %d, terminal %s) Starting pid %d, console %s: '%s' Bummer, could not run '%s': %s The system is going down NOW !! Sending SIGTERM to all processes. Sending SIGKILL to all processes. Trying to re-exec %s exec of '%s' failed: %s ResetCTRL-ALT-DEL The system is halted. Press %s or turn off power Please stand by while rebooting the system. Memory allocation failure r/etc/inittab/sbin/reboot/bin/umount -a -r/sbin/swapoff -a/sbin/init-/bin/sh/etc/init.d/rcS Bad inittab entry: %s /dev/-qinitlinuxrcno process killed/ init started: %s single-s1 No more tasks for init -- sleeping forever. Process '%s' (pid %d) exited. Scheduling it for restart. @ arch_apply_relocationinsmod.cgot != 0isym != ((void *)0)Warning: unhandled reloc %d kjjkjpkjjjFkj.gotarch_create_gotmyrelsec%s multiply definedlocal symbol %s with index %ld exceeds local_symtab_size %ldss.init.modinfosymbol for parameter %s not foundimproperly terminated string argument for %s`u`u`u`u`u`u`u`uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu%u0uuu5u@uuuuuuuuEuuuuPuuUuparm_invalid parameter %sparameter type 'c' for %s must be followed by the maximum sizestring too long for %s (max %ld)unknown parameter type '%c' for %stoo many values for %s (max %d)invalid argument syntax for %stoo few values for %s (min %d)xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdxpxxxuxxxxxxxxxxxxxxxxzzzzzzzzzrzrzzzrzzzzzzzzzzzzzzzzzzzrzzzzzzzzzzzzxzQM_MODULESquery_module: QM_INFO: %squery_module: QM_SYMBOLS: %skernel: QM_SYMBOLSUsing_Versions.this__this_module.kmodtab__ksymtabcorrupt module %s?init_modulecleanup_module__ex_table.text.init.data.init__archdata__kallsymsinit_module: %s.kstrtabunresolved symbol %s.bssRelocation overflowDangerous relocationUnhandled relocation%s of type %ld for %s%s of type %lderror reading ELF headernot an ELF fileELF file not for this architectureELF file not a relocatable objectsection header size mismatch: %lu != %luerror reading ELF section headerserror reading ELF section dataRELA relocations not supported on this architecturecan't handle sections of type %ldsymbol size mismatch: %lu != %lurelocation entry size mismatch: %lu != %lupvvv  D kernel_versionfkvxLo:.or/lib/modules%s/%s%s: no module by that name foundUsing %s Could not load the moduleNot configured to support old kernelsA module named %s already existsCan't allocate kernel memory for module; needed %lu bytescreate_module: %se````````````````````````````````@`````` `0killall%s %2d) %-16s bad signal name: %sBad PIDCould not kill pid '%d'%s: no process killedKernel log daemon exiting.klogd started: BusyBox v0.60.3 (2002.06.10-21:09+0000)klogd: Error return from sys_sycall: %d - %s. ndaemon%lu /sfn/dev/tty0Error opening /dev/tty0Error loading acm(KCannot stat map file16bit screen-map MUST be a regular file.fseek failed reading binary 16bit screen-mapCannot read [new] map from filePIO_UNISCRNMAP ioctlAssuming 8bit screen-map - MUST be a regular file.fseek failed assuming 8bit screen-mapfseek() returned ESPIPE !fseek for binary 8bit screen-mapCannot read [old] map from filePIO_SCRNMAP ioctlError parsing symbolic mapuni_screen_map_read_asciiloadacm.cis_unicodeuni_screen_map_read_ascii() can't read line #U+0123456789abcdefABCDEF%x0x01234567%o0123456789%d6/dev/tty0Error opening /dev/tty0Bad character size %dPIO_FONTX ioctl error (trying PIO_FONT)PIO_FONT ioctl errorPIO_UNIMAPCLRPIO_UNIMAPError reading input fontFont too largeUnsupported psf file modeInput file: bad lengthBad input file sizeGK/dev/tty0Error opening /dev/tty0bkeymapThis is not a valid binary keymap.Error reading keymap flagsError reading keymapunknown facility name: %sunknown priority name: %sp:st:%s no login namedo: %s###"##$# |/@=... %s: %7ld %6s %-10s %4ld %-8.8s %-8.8s%-8d %-8d%4d, %3d %8s %9ld %24.24s %6.6s %5.5s %4.4s [%d;%dm -> %1c1AaCdgilnsxT:w:FpRrSvXcetuLhk444444444444444"4@444444444444444 4444444404@P04ڻл`4ڻp44к4v`@QM_MODULESModule Size Used by module %s: QM_INFOmodule %s: QM_REFS%-20s%8lu%4ld (deleted)(initializing)(uninitialized)(autoclean) (unused)[ %s%s] %dFailed to create: %s xjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ                  #r%s%s: %lu: improperly formatted MD5 checksum line0123456789abcdef%s: FAILED open or read FAILEDOK%s: %s %s: read errormd5sum: %s%s: no properly formatted MD5 checksum lines foundWARNING: %d of %d listed files could not be readWARNING: %d of %d computed checksums did NOT matchg:bcstwthe -b and -t options are meaningless when verifying checksumsthe -g and -c options are mutually exclusivethe -s option is meaningful only when verifying checksumsthe -w option is meaningful only when verifying checksumsno files may be specified when using -g%02x "%s" only one argument may be specified when using -c-\n\\write errorstandard inputm:pinvalid mode `%s'mkfifor/etc/mtab%s is mounted; will not make a filesystem here!%sseek to boot block failed in write_tablesunable to clear boot sectorseek failed in write_tablesunable to write super-blockunable to write inode mapunable to write zone mapunable to write inodesseek failed in write_blockwrite failed in write_blocktoo many bad blocksnot enough good blocksunable to allocate buffers for maps%ld inodes %ld blocks Firstdatazone=%ld (%ld) Zonesize=%d Maxsize=%ld seek failed during testing of blocksWeird values in do_check: probably bugs %d ...seek failed in check_blocksbad blocks before data-area: cannot make fs%d bad blocks one bad block %ld bad inode size%s: not compiled with minix v2 support....badblocksunable to open %sunable to stat %swill not try to make filesystem on '%s'%sAssuming pages of size %dtoo many bad pagesseek failed in check_blocksone bad page %d bad pages %serror: Nowhere to set up swap on?error: size %ld is larger than device size %derror: unknown version %derror: swap area needs to be at least %ldkBwarning: truncating swap area to %ldkBWill not try to make swapdevice on '%s'fatal: first page unreadableUnable to set up swap-space: unreadableSetting up swapspace version %d, size = %ld bytes SWAP-SPACESWAPSPACE2unable to rewind swap-deviceunable to write signature pagefsync failed-q/lib/modules//modules.deprinsmod -k %s 2>/dev/nullacdklnqrst:vVC:-t and -C not supported -s-armmod %s %s %s%s%s No module or pattern provided -k-qinsmod %s %s %s 6BBBBBBBBBBBBBBBBBBBBBBBBBBBBBGBGBBBBBBBBB B0r/dev/tty/dev/console--More-- (%d%% of %ld bytes)Y@, , , , , , , , , |, u, m,  j, g, b, ], X, bindsyncsuidrwroremountnosuidnoexecnodiratimenodevnoatimeexecdiratimedevdefaultsatimeasyncCould not find a spare loop deviceCould not setup loop deviceWARNING: loop device is read-only%s is write-protected, mounting read-onlypermission denied. Are you root?loopautor/proc/filesystemsMounting %s on %s failed/dev/root%s on %s type %s (%s) %so:rt:wafnv/etc/fstab Cannot read /etc/fstabnoautoswapnfsCan't find %s in /etc/fstab ////'/////////////0 0  0 0 0  0  0  0 0  0 0 0 z0 s0 "o0 g0 \0 W0 R0 M0 G0 =0  60 10 *0 0 0  0 !0 0 / / / / weofeofunlockunloadwsettellsetpartdrvbuffersetdensitysetblkseekrewindretensionresetras3ras2ras1rewofflineofflinenopmkpartlockloadfssfsrfsfmfsferaseeomdatacompressionbssbsrbsfmbsf/dev/tape-funrecognized opcode %s.%sAt block %d. unable to stat `%s'cannot overwrite directory with non-directorycannot overwrite non-directory with directorycannot remove `%s'mv: overwrite `%s'? unable to rename `%s'filp:socketbindlistenacceptconnectselectreadwrite%d.%d.%d.%dAddresses: Address: %s , Server: Name: %s%s *** Unknown host ne:f: %s%ld 8<L  --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, %ld%% packet loss round-trip min/avg/max = %lu.%lu/%lu.%lu/%lu.%lu ms sendtoping wrote %d chars; %d expectedEcho ReplyDestination UnreachableSource QuenchRedirect (change route)Echo RequestTime ExceededParameter ProblemTimestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Replyunknown ICMP type%d bytes from %s: icmp_seq=%u ttl=%d time=%lu.%lu ms (DUP!) Warning: Got ICMP %d (%s)unknown address type; only AF_INET is currently supported.PING %s (%s): %d data bytes recvfrompivot_rootinitlinuxrcno process killed-+ #"\abcfnrtv6@GwwQwwwwwwwXwww`wgwppppppppppppppppppapppppppppp(ppppppappp1pappa%sOName: %15cStateState: %cPid:Pid: %d PPid: %d Internal error!Uid:Uid: %dVmSize:VmSize: %d/procCan't open /proc PID Uid VmSize Stat Command /proc/%s/status%d/proc/%s/cmdliner%5d %-8s %c %5d %-8s %6d %c [%s]~tcptimesocket%s%s did not send the complete timespCould not set time of dayinitlinuxrcno process killed%d: old priority %d, new priority %d %d: setprioritycfiRr...cannot remove `.' or `..'unable to remove `%s'parmmod%sdefaultNONEdefault-net-hostcan't resolve %smetricnetmaskcan't resolve netmask %sgwgatewaycan't resolve gw %s%s: cannot use a NETWORK as gateway!mssInvalid MSS.windowInvalid window.irttrejectmoddynreinstatedevicedevlonetmask %.8x doesn't make sense with host routebogus netmask %snetmask doesn't match route addresssocketSIOCDELRTSIOCADDRTr/proc/net/route%lx%lx%X%d%d%d%lxUnsuported kernel route format Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface *%-16s%-16s%-16s%-6s%-6d %-2d %7d %s adddeldeleteflushInvalid RPM header magicUnsupported RPM header versionrCan't open rpm fileInvalid RPM magic; < unterminated match expressionget_address: no address found in string (you probably didn't check the string you passed me)bad format in substitution expression; bad option in substitution expressionbad format in edit expressionmissing commandpdaiconly a beginning address can be specified for edit commandsCommand only uses one addressinvalid command; ; r>=?f>P==?=?=?=?@>=?=?=?=?=?=?==??`=ne:f:-%sMK/dev/consoleerror reading SCANCODE: '%s'SCANCODE or KEYCODE outside boundsKDSETKEYCODEfailed to set SCANCODE %x to KEYCODE %dsleepnrurevenprawmintimeswtcheoleofparityoddpnleksanecbreakpass8litoutcookeddecctlqtabslcaseLCASEcrtdec#H H H 0H 0H  0 H 00H H  G @G G G G G G G G G  G @G G G G G  G G G  G yG sG mG gG `G  ZG @TG PG LG HG DG @G r/etc/fstabswapswapon/etc/fstab file missingwarningwarnpanicnoticenoneinfoerrorerremergdebugcritalertlocal7local6local5local4local3local2local1local0uucpusersyslogsecuritynewsmarkmaillprkernftpdaemoncronauthprivauth/var/log/messages/dev/consoleBummer, can't print: <%d>%s.%ssyslogd: cannot write to remote file handle on%s:%d%s %s %s %s System log daemon exiting.-- MARK --syslogd: cannot create socketsyslogd: cannot connect to remote host %s:%d/dev/logCouldn't get file descriptor for socket /dev/logCould not connect to socket /dev/logCould not set permission on /dev/logsyslogd started: BusyBox v0.60.3 (2002.06.10-21:09+0000)select erroraccept errorm:nO:R:LC d0d0dc0d0dc0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0d0dccP P P mkbc:fhn:q:s:vstandard input-%s %s==> %s <== writeread ==> %s <== fffeffffffffff@ffPfffpfexclude-cxtzvOf:X:pC:Only one 'f' option allowedrcd: %s: %s Creation of compressed not internally support by tar, pipe to busybox gunzipError opening '%s'Couldnt unzip fileExactly one of 'c', 'x' or 't' must be specifiednFoFoFoFoFoFoFoFoFoFoFonFoFoFoFoFoFoFoFoenFoFoFoFoFoFoFoFoFoFosmFo5nnFoFoFoFoFoFoFoFoFoPoFoFoFomFomFomFomUnexpected EOF in archive%s: Cannot create hard link to '%s'%s: Cannot create symlink to '%s'%s: Cannot mknod%s: Cannot mkfifoRemoving leading '/' from member namesBad tar header, skipping%s %d%s/%-d /%-s %ld,%-ld %lu %04d-%02d-%02d %02d:%02d:%02d link to %s -> %s %s Unknown file type '%c' in tar fileError reading tar fileError exit delayed from previous errorsz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{z0{P{p{p{{p{%0*loustar root/%s: Unknown file type%s: socket ignored%s: file is the archive; skipping%s: Cannot open: %sCowardly refusing to create an empty archivewa%s Console escape. Commands are: l go to line mode c go to character mode z suspend telnet e exit telnet continuing...  Escape character is Entering character mode%s'^]'. Entering line mode%s'^C'. TERMConnection closed by foreign host. %s: bad port numberUnable to connect to remote hostyZ vZ sZ pZ mZ jZ gZ dZ aZ  ^Z [Z XZ UZ  RZ  OZ LZ IZ  FZ CZ @Z  =Z  ;Z 8Z 6Z 4Z 0Z ,Z (Z $Z  Z  Z !Z Z Z Z " Z #Z $Z %Z &)(-o-a!-ef-ot-nt-lt-le-gt-ge-ne-eq><!==-S-L-G-O-h-n-z-t-s-k-g-u-p-b-c-d-f-e-x-w-r[]missing ]unknown operandP`u%s: %s%sargument expectedclosing paren expecteds0PpĘ1R0HК`gpwККККК%s: out of range%s: bad numberNo such userFile already existsUnknown transfer IDIllegal TFTP operationDisk full or allocation errorAccess violationFile not foundUndefined errorsockettoo long remote-filenameoctetreadsendrecvfromtimeoutlast timeoutselectserver says: %swritegpl:r:-local filereal %E user %u sys %T\ real %e user %U sys %S\  Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W File system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %x] write errorCommand stopped by signal %d Command terminated by signal %d Command exited with non-zero status %d %lu%ldh %ldm %02lds%ldm %ld.%02lds%ld%lu%%?%%%ld.%02ld%d####################################r###############################Ĩ#ب#P#s#ԩ################0####D##cannot forkcannot run %serror waiting for child process%s%sSTRING2 cannot be empty %s %s (%s)sendtotraceroute: wrote %s %d chars, ret=%d dm:np:q:rs:t:w:vmax ttl must be >1.port must be >0.nprobes must be >0.tos must be 0 to 255.wait must be >1 sec.packet size must be 0 <= s < %d.SO_SNDBUFIP_HDRINCLunknown host %straceroute to %s (%s) from %s, %d hops max, %d byte packets %2d %g ms ! !N !H !P !F !S *@@@88888888Cp8ַ8@оnot a tty rCannot open %s/dev/root/dev/loopforced umount of %s failed!%s busy - remounted read-onlyCannot remount %s read-onlyproc%sCouldn't umount %s on %s: %s  cannot get system nameunknown 000000000000000%s%c%7d %scdurwSs:f:daemonbdflush (update)updateThis kernel does not need update(8). Exiting.pmam %2d:%02d%s up s%d day%s, %2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld %s: Short fileend %s: No `end' line>?456789:;<=@  !"#$%&'()*+,-./0123====%s: data following `=' padding character%s: illegal line%s: No `begin' linebeginbegin-base64 %o %sbegin %o %s%s: Illegal ~user%s: No user `%s'/dev/stdout-w%so:stdinrmrNULL -base64begin%s %o %sCouldnt finish writing ` end ==== $Id: vi.c,v 1.18 2002/04/26 08:06:31 andersen Exp $[%d;%dH viewaAcCdDiIJoOpPrRsxX<>~hCR(window resize)(hangup)(interrupt)(terminate)(bus error)(I tried to touch invalid memory)(alarm)-- caught signal %d %s--Nothing in register %c()[]{}No previous regular expressionsearch hit BOTTOM, continuing at TOPsearch hit TOP, continuing at BOTTOMPattern not found%s :-- Insert ---- Replace --wW^0bBeEft$cdykjHL%+-{} ChangeDeleteYank%s %d lines (%d chars) using [%c]h 3@f 4p0V008F@00 00@fapP400 Q@afp@c hhhhhhhhhhhh%d%n!=%ddeleteeditNo write since last change (:edit! overrides)No current filename"%s" is not a regular file"%s" is not readable [Read only] [New file]"%s"%s%s %dL, %dCfileNo address allowed on this commandfeatureslist $ ^quitnextNo write since last change (:%s! overrides)%d more file to editNo more files to editreadNo filename given"%s"%s %dL, %dCrewindNo write since last change (:rewind! overrides)set---------------------------------------- noautoindent flash ignorecase showmatch tabstop=%d autoindentaiflashflignorecaseicshowmatchsmtabstop=%dsversionwritewq"%s" File is read only"%s" %dL, %dCyankYank %d lines (%d chars) into [%c]:s expression missing delimiters[Hit return to continue] )]}cdy><^%$0bBeEftH-k{L+j} can't create room for new characterscan't delete the characterThese features are available: Pattern searches with / and ? Last command repeat with '.' Line marking with 'x Named buffers with "x Readonly if vi is called as "view" Readonly with -R command line arg Some colon mode commands with ':' Settable options with ":set" Signal catching- ^C Job suspend and resume with ^Z Adapt to window re-sizes(NULL)$Put %d lines (%d chars) from [%c][14~[13~[12~[11~[24~[23~[21~[20~[19~[18~[17~[15~OSOROQOP[6~[5~[2~OFOHODOCOBOA Trying to insert a negative number (%d) of charactersTrying to insert file outside of memorycould not open file"%s" %scould not read file "%s"could not read all of file "%s"'%s' is not implemented [modified]No file"%s"%s%s line %d of %d --%d%%--%7d %s''''''''''''''''''''''''clLw-rtotalABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/buffer overflowcontinuequietoutput-documentheadercqO:P:extra_headers buffer too small(need %i)ftp_proxyhttp_proxyindex.htmlcannot specify continue (-c) without a filename (-O)-awfstat()too many redirectionsfhtGET %stp://%s:%d/%s HTTP/1.1 GET /%s HTTP/1.1 Host: %s User-Agent: Wget Authorization: Basic %s Proxy-Authorization: Basic %s Range: bytes=%ld- Connection: close no response from serverserver returned error %d: %scontent-lengthtransfer-encodingchunkedserver wants to do %s transfer encodinglocationanonymous:busybox@%sPASS ftp login: %sUSER CDUPTYPE ISIZE /PASVPASV: %sREST %ldRETR /RETR: %sfwritenetwork read errorftp error: %sQUIThttp://ftp://not an http or ftp url: %ssocket()connect()r+fdopen()bad header line: %s%s%s fgets() KMGTP %-20.20s %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5d %c%c - stalled - --:-- ETA%2d: %02d:%02d ETAY@.APATH/bin:/sbin:/usr/bin:/usr/sbin:/usr/local/bincannot find username for UID %u/bin/echo rpopenyyes/usr/bin/usr/sbin| | | | | %sapplet not found--install-s/proc/self/exe%s Usage: busybox [function] [arguments]... or: [function] [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use, and BusyBox will act like whatever it was invoked as. Currently defined functions: , %s%s, COMMAND's resource usage information is displayed Options: -v Displays verbose resource usage information.[-q] [-o offset] [-f frequency] [-p timeconstant] [-t tick] Reads and optionally sets system timebase parameters. See adjtimex(2). Options: -q quiet mode - do not print -o offset time offset, microseconds -f frequency frequency adjust, integer kernel units (65536 is 1ppm) (positive values make the system clock run fast) -t tick microseconds per tick, usually 10000 -p timeconstant -[ov][ptx] ARCHIVE FILES Extract or list FILES from an ar archive. Options: -o preserve original dates -p extract to stdout -t list -x extract -v verbosely list files processed FILE [SUFFIX] Strips directory path and suffixes from FILE. If specified, also removes any trailing SUFFIX.[FILE]... Concatenates FILE(s) and prints them to stdout.[OPTION]... GROUP FILE... Change the group membership of each FILE to GROUP. Options: -R Changes files and directories recursively.[-R] MODE[,MODE]... FILE... Each MODE is one or more of the letters ugoa, one of the symbols +-= and one or more of the letters rwxst. Options: -R Changes files and directories recursively.[ -Rh ]... OWNER[<.|:>[GROUP]] FILE... Change the owner and/or group of each FILE to OWNER and/or GROUP. Options: -R Changes files and directories recursively. -h Do not dereference symbolic links.NEWROOT [COMMAND...] Run COMMAND with root directory set to NEWROOT.N Changes the foreground virtual terminal to /dev/ttyN Clear screen.FILE1 [FILE2] -s quiet mode - do not print Compare files.[OPTION]... SOURCE DEST Copies SOURCE to DEST, or multiple SOURCE(s) to DIRECTORY. -a Same as -dpR -d Preserves links -p Preserves file attributes if possible -f force (implied; ignored) - always set -R Copies directories recursively-[dimtuv][F cpiofile] Extract or list files from a cpio archive Main operation mode: d make leading directories i extract m preserve mtime t list u unconditional overwrite F input from file [OPTION]... [FILE]... Prints selected fields from each input FILE to standard output. Options: -b LIST Output only bytes from LIST -c LIST Output only characters from LIST -d CHAR Use CHAR instead of tab as the field delimiter -s Output only the lines containing delimiter -f N Print only these fields -n Ignored[OPTION]... [+FORMAT] Displays the current time in the given FORMAT, or sets the system date. Options: -R Outputs RFC-822 compliant date string -d STRING display time described by STRING, not `now' -s Sets time described by STRING -u Prints or sets Coordinated Universal Timeexpression ... This is a Tiny RPN calculator that understands the following operations: +, -, /, *, and, or, not, eor. i.e., 'dc 2 2 add' -> 4, and 'dc 8 8 \* 2 2 + /' -> 16[if=FILE] [of=FILE] [bs=N] [count=N] [skip=N] [seek=N] [conv=notrunc|noerror|sync] Copy a file, converting and formatting according to options if=FILE read from FILE instead of stdin of=FILE write to FILE instead of stdout bs=N read and write N bytes at a time count=N copy only N input blocks skip=N skip N input blocks seek=N skip N output blocks conv=notrunc don't truncate output file conv=noerror continue after read errors conv=sync pad blocks with zeros Numbers may be suffixed by c (x1), w (x2), b (x512), kD (x1000), k (x1024), MD (x1000000), M (x1048576), GD (x1000000000) or G (x1073741824).N Deallocate unused virtual terminal /dev/ttyN[-hmk] [FILESYSTEM ...] Print the filesystem space used and space available. Options: -h print sizes in human readable format (e.g., 1K 243M 2G ) -m print sizes in megabytes -k print sizes in kilobytes(default)[FILENAME ...] Strips non-directory suffix from FILENAME[-c] [-n LEVEL] [-s SIZE] Prints or controls the kernel ring buffer Options: -c Clears the ring buffer's contents after printing -n LEVEL Sets console logging level -s SIZE Use a buffer of size SIZE[option] [FILE] Converts FILE from dos format to unix format. When no option is given, the input is converted to the opposite output format. When no file is given, uses stdin for input and stdout for output. Options: -u output will be in UNIX format -d output will be in DOS format[-lsxhmk] [FILE]... Summarizes disk space used for each FILE and/or directory. Disk space is printed in units of 1024 bytes. Options: -l count sizes many times if hard linked -s display only a total for each argument -h print sizes in human readable format (e.g., 1K 243M 2G ) -m print sizes in megabytes -x skip directories on different filesystems -k print sizes in kilobytes(default)> keymap Prints out a binary keyboard translation table to standard output.[FILE] Dump utmp file format (pipe delimited) from FILE or stdin to stdout. (i.e., 'dutmp /var/run/utmp')[-neE] [ARG ...] Prints the specified ARGs to stdout Options: -n suppress trailing newline -e interpret backslash-escaped characters (i.e., \t=tab) -E disable interpretation of backslash-escaped characters[-iu] [-] [name=value]... [command] Prints the current environment or runs a program after setting up the specified environment. Options: -, -i start with an empty environment -u remove variable from the environment EXPRESSION Prints the value of EXPRESSION to standard output. EXPRESSION may be: ARG1 | ARG2 ARG1 if it is neither null nor 0, otherwise ARG2 ARG1 & ARG2 ARG1 if neither argument is null or 0, otherwise 0 ARG1 < ARG2 ARG1 is less than ARG2 ARG1 <= ARG2 ARG1 is less than or equal to ARG2 ARG1 = ARG2 ARG1 is equal to ARG2 ARG1 != ARG2 ARG1 is unequal to ARG2 ARG1 >= ARG2 ARG1 is greater than or equal to ARG2 ARG1 > ARG2 ARG1 is greater than ARG2 ARG1 + ARG2 arithmetic sum of ARG1 and ARG2 ARG1 - ARG2 arithmetic difference of ARG1 and ARG2 ARG1 * ARG2 arithmetic product of ARG1 and ARG2 ARG1 / ARG2 arithmetic quotient of ARG1 divided by ARG2 ARG1 % ARG2 arithmetic remainder of ARG1 divided by ARG2 STRING : REGEXP anchored pattern match of REGEXP in STRING match STRING REGEXP same as STRING : REGEXP substr STRING POS LENGTH substring of STRING, POS counted from 1 index STRING CHARS index in STRING where any CHARS is found, or 0 length STRING length of STRING quote TOKEN interpret TOKEN as a string, even if it is a keyword like `match' or an operator like `/' ( EXPRESSION ) value of EXPRESSION Beware that many operators need to be escaped or quoted for shells. Comparisons are arithmetic if both ARGs are numbers, else lexicographical. Pattern matches return the string matched between \( and \) or null; if \( and \) are not used, they return the number of characters matched or 0. Return an exit code of FALSE (1).[options] [mode] Show and modify frame buffer settingsDEVICE Forces floppy disk drive to detect disk change[PATH...] [EXPRESSION] Search for files in a directory hierarchy. The default PATH is the current directory; default EXPRESSION is '-print' EXPRESSION may consist of: -follow Dereference symbolic links. -name PATTERN File name (leading directories removed) matches PATTERN. -print Print (default and assumed). -type X Filetype matches X (where X is one of: f,d,l,b,c,...) -perm PERMS Permissions match any of (+NNN); all of (-NNN); or exactly (NNN) -mtime TIME Modified time is greater than (+N); less than (-N); or exactly (N) days -newer FILE Modified time is more recent than FILE's Displays the amount of free and used system memoryDEVICE Frees all memory used by the specified ramdisk.[-larvsmf] /dev/name Performs a consistency check for MINIX filesystems. Options: -l Lists all filenames -r Perform interactive repairs -a Perform automatic repairs -v verbose -s Outputs super-block information -m Activates MINIX-like "mode not cleared" warnings -f Force file system check.[OPTIONS]... Parse command options -a, --alternative Allow long options starting with single - -l, --longoptions=longopts Long options to be recognized -n, --name=progname The name under which errors are reported -o, --options=optstring Short options to be recognized -q, --quiet Disable error reporting by getopt(3) -Q, --quiet-output No normal output -s, --shell=shell Set shell quoting conventions -T, --test Test for getopt(1) version -u, --unqote Do not quote the output[-ihHnqvs] PATTERN [FILEs...] Search for PATTERN in each FILE or standard input. Options: -H prefix output lines with filename where match was found -h suppress the prefixing filename on output -i ignore case distinctions -l list names of files that match -n print line number with output lines -q be quiet. Returns 0 if result was found, 1 otherwise -v select non-matching lines -s suppress file open/read error messages[OPTION]... FILE Uncompress FILE (or standard input if FILE is '-'). Options: -c Write output to standard output -t Test compressed file integrity[OPTION]... FILE Compress FILE with maximum compression. When FILE is '-', reads standard input. Implies -c. Options: -c Write output to standard output instead of FILE.gz -d decompress Halt the system.[OPTION] [FILE]... Print first 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -n NUM Print first NUM lines instead of first 10 Print out a unique 32-bit identifier for the machine.[OPTION] {hostname | -F FILE} Get or set the hostname or DNS domain name. If a hostname is given (or FILE with the -F parameter), the host name will be set. Options: -s Short -i Addresses for the hostname -d DNS domain name -F, --file FILE Use the contents of FILE to specify the hostname[OPTIONS]... [USERNAME] Print information for USERNAME or the current user Options: -g prints only the group ID -u prints only the user ID -n print a name instead of a number (with for -ug) -r prints the real user ID instead of the effective ID (with -ug)[-a] [

] configure a network interface Options: [[-]broadcast [
]] [[-]pointopoint [
]] [netmask
] [dstaddr
] [outfill ] [keepalive ] [hw ether
] [metric ] [mtu ] [[-]trailers] [[-]arp] [[-]allmulti] [multicast] [[-]promisc] [txqueuelen ] [[-]dynamic] [mem_start ] [io_addr ] [irq ] [up|down] ... Init is the parent of all processes.[OPTION]... MODULE [symbol=value]... Loads the specified kernel modules into the kernel. Options: -f Force module to load into the wrong kernel version. -k Make module autoclean-able. -v verbose output -L Lock to prevent simultaneous loads of a module -x do not export externs[-signal] process-id [process-id ...] Send a signal (default is SIGTERM) to the specified process(es). Options: -l List all signal names and numbers.[-signal] process-name [process-name ...] Send a signal (default is SIGTERM) to the specified process(es). Options: -l List all signal names and numbers.-n Kernel logger. Options: -n Run as a foreground process.STRING Prints out the length of the specified STRING.[OPTION] TARGET... LINK_NAME|DIRECTORY Create a link named LINK_NAME or DIRECTORY to the specified TARGET You may use '--' to indicate that all following arguments are non-options. Options: -s make symbolic links instead of hard links -f remove existing destination files -n no dereference symlinks - treat like normal file< mapfile Loads an acm from standard input.< font Loads a console font from standard input.< keymap Loads a binary keyboard translation table from standard input.[OPTION]... [MESSAGE] Write MESSAGE to the system log. If MESSAGE is omitted, log stdin. Options: -s Log to stderr as well as the system log. -t Log using the specified tag (defaults to user name). -p Enter the message with the specified priority. This may be numerical or a ``facility.level'' pair. Print the name of the current user.[OPTION]... LOOPDEVICE [FILE] Associate LOOPDEVICE with FILE. Options: -d Disassociate LOOPDEVICE. -o OFFSET Start OFFSET bytes into FILE. [-1AacCdeFilnpLRrSsTtuvwxXhk] [filenames...] List directory contents Options: -1 list files in a single column -A do not list implied . and .. -a do not hide entries starting with . -C list entries by columns -c with -l: show ctime -d list directory entries instead of contents -e list both full date and full time -F append indicator (one of */=@|) to entries -i list the i-node for each file -l use a long listing format -n list numeric UIDs and GIDs instead of names -p append indicator (one of /=@|) to entries -L list entries pointed to by symbolic links -R list subdirectories recursively -r sort the listing in reverse order -S sort the listing by file size -s list the size of each file, in blocks -T NUM assume Tabstop every NUM columns -t with -l: show modification time -u with -l: show access time -v sort the listing by version -w NUM assume the terminal is NUM columns wide -x list entries by lines instead of by columns -X sort the listing by extension -h print sizes in human readable format (e.g., 1K 243M 2G ) -k print sizes in kilobytes(default) List the currently loaded kernel modules.NAME TYPE MAJOR MINOR FIRST LAST [s] Creates a range of block or character special files TYPEs include: b: Make a block (buffered) device. c or u: Make a character (un-buffered) device. p: Make a named pipe. MAJOR and MINOR are ignored for named pipes. FIRST specifies the number appended to NAME to create the first device. LAST specifies the number of the last item that should be created. If 's' is the last argument, the base device is created as well. For example: makedevs /dev/ttyS c 4 66 2 63 -> ttyS2-ttyS63 makedevs /dev/hda b 3 0 0 8 s -> hda,hda1-hda8[OPTION] [FILE]... or: md5sum [OPTION] -c [FILE] Print or check MD5 checksums. Options: With no FILE, or when FILE is -, read standard input. -b read files in binary mode -c check MD5 sums against given list -t read files in text mode (default) -g read a string The following two options are useful only when verifying checksums: -s don't output anything, status code shows success -w warn about improperly formated MD5 checksum lines[OPTION] DIRECTORY... Create the DIRECTORY(ies) if they do not already exist Options: -m set permission mode (as in chmod), not rwxrwxrwx - umask -p no error if existing, make parent directories as needed[OPTIONS] name Creates a named pipe (identical to 'mknod name p') Options: -m create the pipe using the specified mode (default a=rw)[-c | -l filename] [-nXX] [-iXX] /dev/name [blocks] Make a MINIX filesystem. Options: -c Check the device for bad blocks -n [14|30] Specify the maximum length of filenames -i INODES Specify the number of inodes for the filesystem -l FILENAME Read the bad blocks list from FILENAME -v Make a Minix version 2 filesystem[OPTIONS] NAME TYPE MAJOR MINOR Create a special file (block, character, or pipe). Options: -m create the special file using the specified mode (default a=rw) TYPEs include: b: Make a block (buffered) device. c or u: Make a character (un-buffered) device. p: Make a named pipe. MAJOR and MINOR are ignored for named pipes.[-c] [-v0|-v1] device [block-count] Prepare a disk partition to be used as a swap partition. Options: -c Check for read-ability. -v0 Make version 0 swap [max 128 Megs]. -v1 Make version 1 swap [big!] (default for kernels > 2.1.117). block-count Number of block to use (default is entire partition).[-q] TEMPLATE Creates a temporary file with its name based on TEMPLATE. TEMPLATE is any name with six `Xs' (i.e., /tmp/temp.XXXXXX).[FILE ...] Used for hight level module loading and unloading.[FILE ...] More is a filter for viewing FILE one screenful at a time.[flags] DEVICE NODE [-o options,more-options] Mount a filesystem Flags: -a: Mount all filesystems in fstab. -o option: One of many filesystem options, listed below. -r: Mount the filesystem read-only. -t fs-type: Specify the filesystem type. -w: Mount for reading and writing (default). Options for use with the "-o" flag: async/sync: Writes are asynchronous / synchronous. atime/noatime: Enable / disable updates to inode access times. dev/nodev: Allow use of special device files / disallow them. exec/noexec: Allow use of executable files / disallow them. loop: Mounts a file via loop device. suid/nosuid: Allow set-user-id-root programs / disallow them. remount: Re-mount a mounted filesystem, changing its flags. ro/rw: Mount for read-only / read-write. bind: Use the linux 2.4.x "bind" feature. There are EVEN MORE flags that are specific to each filesystem. You'll have to see the written documentation for those filesystems.[-f device] opcode value Control magnetic tape drive operation Available Opcodes: bsf bsfm bsr bss datacompression drvbuffer eof eom erase fsf fsfm fsr fss load lock mkpart nop offline ras1 ras2 ras3 reset retension rew rewoffline seek setblk setdensity setpart tell unload unlock weof wsetSOURCE DEST or: mv SOURCE... DIRECTORY Rename SOURCE to DEST, or move SOURCE(s) to DIRECTORY.[OPTIONS] [IP] [port] Netcat opens a pipe to IP:port Options: -l listen mode, for inbound connects -p PORT local port number -e PROG program to exec after connect (dangerous!)[HOST] [SERVER] Queries the nameserver for the IP address of the given HOST optionally using a specified DNS serverprocess-name [process-name ...] Lists the PIDs of all processes with names that match the names on the command line[OPTION]... host Send ICMP ECHO_REQUEST packets to network hosts. Options: -c COUNT Send only COUNT pings. -s SIZE Send SIZE data bytes in packets (default=56). -q Quiet mode, only displays output at start and when finished.NEW_ROOT PUT_OLD Move the current root file system to PUT_OLD and make NEW_ROOT the new root file system. Halt the system and request that the kernel shut off the power.FORMAT [ARGUMENT...] Formats and prints ARGUMENT(s) according to FORMAT, Where FORMAT controls the output exactly as in C printf. Report process status This version of ps accepts no options. Print the full filename of the current working directory.[OPTION] HOST Get and possibly set the system date and time from a remote HOST. Options: -s Set the system date and time (default). -p Print the date and time. Read a symbolic link. Reboot the system.priority pid [pid ...] Changes priority of running processes. Allowed priorities range from 20 (the process runs only when nothing else is running) to 0 (default priority) to -20 (almost nothing else ever gets to run). Resets the screen.[OPTION]... FILE... Remove (unlink) the FILE(s). You may use '--' to indicate that all following arguments are non-options. Options: -i always prompt before removing each destination -f remove existing destinations, never prompt -r or -R remove the contents of directories recursively[OPTION]... DIRECTORY... Remove the DIRECTORY(ies), if they are empty.[OPTION]... [MODULE]... Unloads the specified kernel modules from the kernel. Options: -a Try to remove all unused kernel modules.[{add|del|flush}] Edit the kernel's routing tablespackage.rpm Outputs a cpio archive of the rpm file.[-nef] pattern [files...] Options: -n suppress automatic printing of pattern space -e script add the script to the commands to be executed -f scriptfile add the contents of script-file to the commands to be executed If no -e or -f is given, the first non-option argument is taken as the sed script to interpret. All remaining arguments are names of input files; if no input files are specified, then the standard input is read.SCANCODE KEYCODE ... Set entries into the kernel's scancode-to-keycode map, allowing unusual keyboards to generate usable keycodes. SCANCODE may be either xx or e0xx (hexadecimal), and KEYCODE is given in decimalN Pause for N seconds.[-nru] [FILE]... Sorts lines of text in the specified files Options: -u suppress duplicate lines -r sort in reverse order -n sort numerics[-a|g] [-F DEVICE] [SETTING]... Without arguments, prints baud rate, line discipline, and deviations from stty sane. Options: -F DEVICE open device instead of stdin -a print all current settings in human-readable form -g print in stty-readable form [SETTING] see manpage[OPTION] [DEVICE] Stop swapping virtual memory pages on DEVICE. Options: -a Stop swapping on all swap devices[OPTION] [DEVICE] Start swapping virtual memory pages on DEVICE. Options: -a Start swapping on all swap devices Write all buffered filesystem blocks to disk.[OPTION]... Linux system and kernel logging utility. Note that this version of syslogd ignores /etc/syslog.conf. Options: -m NUM Interval between MARK lines (default=20min, 0=off) -n Run as a foreground process -O FILE Use an alternate log file (default=/var/log/messages) -R HOST[:PORT] Log to IP or hostname on PORT (default PORT=514/UDP) -L Log locally and via network logging (default is network only)[OPTION]... [FILE]... Print last 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -c N[kbm] output the last N bytes -n N[kbm] print last N lines instead of last 10 -f output data as the file grows -q never output headers giving file names -s SEC wait SEC seconds between reads with -f -v always output headers giving file names If the first character of N (bytes or lines) is a '+', output begins with the Nth item from the start of each file, otherwise, print the last N items in the file. N bytes may be suffixed by k (x1024), b (x512), or m (1024^2).-[cxtvO] [--exclude FILE] [-X FILE][-f TARFILE] [-C DIR] [FILE(s)] ... Create, extract, or list files from a tar file. Options: c create x extract t list File selection: f name of TARFILE or "-" for stdin O extract to stdout exclude file to exclude X file with names to exclude C change to directory DIR before operation v verbosely list files processed[OPTION]... [FILE]... Copy standard input to each FILE, and also to standard output. Options: -a append to the given FILEs, do not overwriteHOST [PORT] Telnet is used to establish interactive communication with another computer over a network using the TELNET protocol.EXPRESSION or [ EXPRESSION ] Checks file types and compares values returning an exit code determined by the value of EXPRESSION.[OPTION]... HOST [PORT] Transfers a file from/to a tftp server using "octet" mode. Options: -b SIZE Transfer blocks of SIZE octets. -g Get file. -l FILE Transfer local FILE. -p Put file. -r FILE Transfer remote FILE. [OPTION]... COMMAND [ARGS...] Runs the program COMMAND with arguments ARGS. When COMMAND finishes, [-c] FILE [FILE ...] Update the last-modified date on the given FILE[s]. Options: -c Do not create any files[-cds] STRING1 [STRING2] Translate, squeeze, and/or delete characters from standard input, writing to standard output. Options: -c take complement of STRING1 -d delete input characters coded STRING1 -s squeeze multiple output characters of STRING2 into one character[-dnrv] [-m max_ttl] [-p port#] [-q nqueries] [-s src_addr] [-t tos] [-w wait] host [data size] trace the route ip packets follow going to "host" Options: -d set SO_DEBUG options to socket -n Print hop addresses numerically rather than symbolically -r Bypass the normal routing tables and send directly to a host -v Verbose output -m max_ttl Set the max time-to-live (max number of hops) -p port# Set the base UDP port number used in probes (default is 33434) -q nqueries Set the number of probes per ``ttl'' to nqueries (default is 3) -s src_addr Use the following IP address as the source address -t tos Set the type-of-service in probe packets to the following value (default 0) -w wait Set the time (in seconds) to wait for a response to a probe (default 3 sec.). Return an exit code of TRUE (0). Print the file name of the terminal connected to standard input. Options: -s print nothing, only return an exit status[flags] FILESYSTEM|DIRECTORY Unmount file systems Flags: -a Unmount all file systems -r Try to remount devices as read-only if mount is busy -f Force umount (i.e., unreachable NFS server) -l Do not free loop device (if a loop device has been used)[OPTION]... Print certain system information. With no OPTION, same as -s. Options: -a print all information -m the machine (hardware) type -n print the machine's network node hostname -r print the operating system release -s print the operating system name -p print the host processor type -v print the operating system version[OPTION]... [INPUT [OUTPUT]] Discard all but one of successive identical lines from INPUT (or standard input), writing to OUTPUT (or standard output). Options: -c prefix lines by the number of occurrences -d only print duplicate lines -u only print unique lines[option] [FILE] Converts FILE from unix format to dos format. When no option is given, the input is converted to the opposite output format. When no file is given, uses stdin for input and stdout for output. Options: -u output will be in UNIX format -d output will be in DOS format[options] Periodically flushes filesystem buffers. Options: -S force use of sync(2) instead of flushing -s SECS call sync this often (default 30) -f SECS flush some buffers this often (default 5) Display the time since the last boot.N Pause for N microseconds.[FILE]... Uudecode a file that is uuencoded. Options: -o FILE direct output to FILE[OPTION] [INFILE] REMOTEFILE Uuencode a file. Options: -m use base64 encoding per RFC1521[OPTION] [FILE]... edit FILE. Options: -R Read-only- do not write to the file.DEV Periodically write to watchdog device DEV[OPTION]... [FILE]... Print line, word, and byte counts for each FILE, and a total line if more than one FILE is specified. With no FILE, read standard input. Options: -c print the byte counts -l print the newline counts -L print the length of the longest line -w print the word counts[-c|--continue] [-q|--quiet] [-O|--output-document file] [--header 'header: value'] [-P DIR] url wget retrieves files via HTTP or FTP Options: -c continue retrieval of aborted transfers -q quiet mode - do not print -P Set directory prefix to DIR -O save to filename ('-' for stdout)[COMMAND ...] Locates a COMMAND. Prints the user name associated with the current effective user id.[COMMAND] [ARGS...] Executes COMMAND on every item given by standard input.[OPTION]... [STRING]... Repeatedly outputs a line with all specified STRING(s), or 'y'.FILE Uncompress to stdout.    +  H  \     `   P  D     8  @ P  { `v Pp l g a [ S 0N XI = @2  + X&  0  . H `I J K `M O  : 3 - (  P  `   \  P& ( + C E `E G 0 zcatyesxargswhoamiwhichwgetwcwatchdogviuuencodeuudecodeusleepuptimeupdateunix2dosuniqunameumountttytruetraceroutetrtouchtimetftptesttelnetteetartailsyslogdsyncswaponswapoffsttysortsleepshsetkeycodessedrpm2cpioroutermmodrmdirrmresetrenicerebootreadlinkrdatepwdpsprintfpoweroffpivot_rootpingpidofnslookupncmvmtmountmoremodprobemktempmkswapmknodmkfs.minixmkfifomkdirmd5summakedevslsmodlslosetuplognameloggerloadkmaploadfontloadacmlnlinuxrclengthklogdkillallkillinsmodinitifconfigidhostnamehostidheadhaltgzipgunzipgrepgetoptfsck.minixfreeramdiskfreefindfdflushfbsetfalseexprenvegrepechodutmpdumpkmapdudos2unixdmesgdirnamedfdeallocvtdddcdatecutcpiocpcmpclearchvtchrootchownchmodchgrpcatbusyboxbasenameasharadjtimex[%s Usage: %s %s %s No help available. --helpBusyBox v0.60.3 (2002.06.10-21:09+0000) multi-call binary` memory exhausted invalid date `%s' %s: input/output error -- %s Write Error too few arguments Names longer than %d chars not supported. (unknown)P can`t create raw socket` Invalid magicCannot resolve long file name /07070Unsupported format or invalid magic%6c%8x%8x%8x%8x%8x%8lx%8lx%16c%8x%8x%8x%8cTRAILER!!!%d blocks %s not created: cannot resolve hardlinkerror resolving hardlink: did you create the archive with GNU cpio 2.0-2.2?Unsupported formatStream error/%s%s%s%sunable to stat `%s'`%s' and `%s' are the same file%s: omitting directory`%s' is not a directorycannot create directory `%s'unable to open directory `%s'...unable to close directory `%s'unable to change permissions of `%s'%s: overwrite `%s'? wunable to open `%s'unable to remove `%s'runable to close `%s'unable to create `%s'cannot create fifo `%s'cannot create symlink `%s'unable to preserve ownership of `%s'internal error: unrecognized file typeunable to preserve times of `%s'unable to preserve permissions of `%s'readUnable to read all datawriteUnable to write all datar/procCannot open /proc../proc/%s/statusr%*s %s/could not stat '/'/devcould not open '/dev'../dev/root3K/dev/tty/dev/tty0/dev/consoleCouldn't get a file descriptor referring to the consolePpipe errorfork failedwgzip stream init failedr0kMGT%Lu%Lu.%d%ccannot get system information.%sioctl: LOOP_CLR_FDioctl: LOOP_SET_FDioctl: LOOP_SET_STATUS/dev/loop%d@ rwxrwxrwx---------..s..s..t..S..S..T0pcCd?bB-?l?s???/proc/mountsunknown group name: %s%-8ld unknown user name: %sunknown user name: %sunknown gid %ld%-8ld 8$I ugoarwxstinvalid number `%s'%s: Is directoryrabfnrtv\ \\%s...%s ??gzip aborted Couldnt writeIncomplete literal treeincomplete distance treeInvalid gzip magicunknown method %d -- get newer version of gzipit failed invalid compressed data--format violatedinternal error, invalid methodinvalid compressed data--crc errorinvalid compressed data--length error*** Couldnt kill old gunzip process *** abortingCouldnt wait ?%s: : %s%s %sxstrndup bug%sgetcwd()P%s:%sxregcomp: %sdefault*[NONE SET]DARPA Internetinet%02X-UNSPECunspec/proc/netNo usable address families found. warning: no inet socket available: %s SIOCGIFCONF%Lu %Lu %lu %lu %lu %lu %lu %lu %Lu %Lu %lu %lu %lu %lu %lu %lu%Lu %Lu %lu %lu %lu %lu %Lu %Lu %lu %lu %lu %lu %lu%Lu %lu %lu %lu %lu %Lu %lu %lu %lu %lu %lucompressedbytesr/proc/net/devWarning: cannot open %s (%s). Limited output. Device not found%s: error fetching interface information: %s Local Loopbackloop%02X:%02X:%02X:%02X:%02X:%02XEthernetetherPoint-Point Protocolppp100baseFX100baseTX100baseTdb15thickAUItpeutp10baseTcoaxbnc10base2unknownkMX bytes:%Lu (%Lu.%lu %sb)%s%-9.9s Link encap:%s HWaddr %s Media:%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s [NO FLAGS] UP BROADCAST DEBUG LOOPBACK POINTOPOINT NOTRAILERS RUNNING NOARP PROMISC ALLMULTI SLAVE MASTER MULTICAST MTU:%d Metric:%dRX packets:%Lu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%Lu errors:%lu dropped:%lu overruns:%lu carrier:%lu collisions:%lu compressed:%lu txqueuelen:%d R TInterrupt:%d Base address:0x%lx Memory:%lx-%lx DMA chan:%x socketunable to stat `%s'cannot remove `%s'%s: is a directory%s: descend into directory `%s'? unable to open `%s'...unable to close `%s'%s: remove directory `%s'? unable to remove `%s'%s: remove `%s'? readwrite%s.Cannot create directory `%s'Cannot set permissions of directory `%s'icmppermission denied. (are you root?)v r n i e ` \ W  R  M  H C >  9  4 / * %                     UNUSEDWINCHPWRPROFVTALRMXFSZXCPUCLDPOLLIOURGSTKFLTSYSBUSIOTTRAPTTOUTTINTSTPSTOPCONTCHLDUSR2USR1TERMALRMPIPESEGVKILLFPEABRTILLQUITINTHUPEXITSIG%d./%s not created: newer or same age file existscouldn't create leading directoriesCannot link from %s to '%s'wextract_archive: %sCannot create symlink from %s to '%s'Cannot create node %s%s %d/%d %8d %s %s : )  @ypf\RI@и1 1 3 W  @=P   w t 8ol}qpQjseT\uPaKn    @      TERM=linux/dev/consoleP O?M :M 4M .M *M $M M M M  M M M M  M PM HM M XM M 0M M M 8M  M (M }M @vM oM hM aM ZM SM LM EM M Q e&\ \ \ [ [ [ [ [ ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/`!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_1u -u )u %u !u u j u u u  u  u u t t t t t t t t t t t t t t t t t t   #+3;CScscc !1Aa  0@`        l  ؎ ' @'   ؎    $  ' ' ( ' u m i d \ X T P J E < 2 (  Э (x  ) xo0oo( .>N^n~ήޮ.>N^n~ίޯ.>N^n~ΰް.>N^n~αޱ.>N^n~β޲.>N^n~γ޳.>N^n~δ޴.>N^n~ε޵.>N^n~ζ޶.>N^n~η޷.>N^n~θ޸.>N^n~ι޹.>N^n~κ޺.>N^n~λ޻.>N^n~μ޼.>N^n~.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.dyn.rel.plt.init.text.fini.rodata.data.eh_frame.dynamic.ctors.dtors.got.bss  !((`'  /xx7o#Do00%`S %x\ & eЭ-%`-k=`q8w  8P   ( ( ) ) ) - + ELF4 74 (4443335 /lib/ld-linux.so.2GNUCF2#E4*6@730?$ %BAD8<.>:/)5!=  ",+&-9;('1C3 |g^,/</L}"\=l6T|87*./H̍܍./IW Vq,L!<LpL5\/7l|"'P[Ti LCbe̎}܎77w 7 ,<kL;+L\5L!l?|*=&̏܏,&! =;EX,<ĩ'L \;lO|pBL;&/ ̐ __gmon_start__libc.so.6strcpyioctlstdoutstrerrormemmovesnprintfgetenvbsearchexecvegetpidfgetsdup2mallocsleepsysinfofflushputenvgetpgrpunamestrrchrcallocwriteenvironfprintfkill__deregister_frame_inforebootchdirstdinwaitstrstrsignalstrncmpstrncpysync_IO_getcstrtokforkstrncatmemsettcgetattrbdflushstrcmpstderrstrsep__xstat__errno_locationexitfopenatoi_IO_putcfileno_IO_stdin_used__libc_start_mainopenvdprintfstrchrsetsidfcntltcsetattr__register_frame_infoclosevfprintfstrpbrktcsetpgrpfree__environ_environGLIBC_2.1GLIBC_2.0ii >ii HDPTL)X8       $ (!,"0#4$8%<&@'D(H*L,P-T.X/\0`1d2h3l4p5t6x7|9:<=>?@ABCEUS[7j[5%%h%h%h%h%h %h(%h0%h8p%h@`%hHP%hP@%hX0%h` %hh%hp%hx%h%h%h%h%h%h% h%hp%h`%hP%h@% h0%$h %(h%,h%0h%4h%8h%<h%@h%Dh %Hh(%Lh0%Ph8p%Th@`%XhHP%\hP@%`hX0%dh` %hhh%lhp%phx%th%xh%|h%h%h%h%h%hp%h`%hP%h@%h0%h 1^PTRhhԌQVh ;US[Ø3t[ÐU=u>PС8u|t h ÐUULth\hÐUÐVS\$ t$$=@}iu@OhP@}5@5h5Tot@|D$(PVR_teh hĪÃ| D$(PVS-S-hѪ5TD$8PV5T [^ÃTVSt$`\$SVD$5D$6D$7D$8D$9D$=D$>D$?D$4D$,% D$,D$$D$(D$0;SjV [^TÍvTVS D$Pqth>&t$DuuKuuT$ D$0[^TÍvPWVS11htPhjh|htPhjh SD$PhTjut$hjh OD$LPhVjuD$HPh&jh hĪhjh hh Ã}auhĪhjh uh1hjh m렅}h;jh SD$PhTjueƿE uhPjPh`jSh hj[^_PÉ UWVSl$$\$(UװэqVjRVSu |$ ~+TװэAPjRF9t$ [^_] ÉUWVSh<1L8t&Dždh`htyDž\&j=h\42CÃ\1)SPL44 t\d\<0udhuLd`DGL<9Pjh"Tjj jj jj "jj  jjjj jjjM Q"à }YPE PjtU RhjjlM Qhj}jOvjSjS jSjhTj PjDj. hutjDž̬Džլجܬf߰Ѹ)PuS Dž@1:t GhެURlƒu׍>-u`FVÃ߰эAP uhj t&-S@P}u2j.h5P}Pd5Xf hPPV0PVhj0jRH[^_ÐSt$,t$,t$,Ã&D$P~9u9u[Ívl=pD$Ph ju7jh h+zjh hDf V=h`jjlÐWVS|$ t9t&9u!jPCPS| u[^_à jjAhͫ hj hj jjj5 h jj jb jj H= wjjj É 4J=uDPh`jULj |$ u=~h!Ch#j hjj* hgE#Jj j à UWVSl$(}u =u,h U?t; h jbÃuhήj>j}ht$,CPuD$0hUPV [^_] Ð D$1ɋ&ыt-9uu  R ÍvUWVShhD$,h hjh hj} h hjfh h̬jR tPh̬j6tPh̬jtPh̬jh h(j{D$$ C< t< t<#.< &j StV$,D$ PAj:S x@j:Pbƃ~Fj:V<ǃt}G=tdVukuH;t+OD$ SfD$$hS\$,SSWuD$(}u|$tD$Ph8j<D$ Ph$,V+[^_]ÐUWVSl$0\$4`thU5tuh@j h@j hjhj jj7 j*j jWh]f h5dh_j Cƿst&ƿztƿ}ustPh̬jtPh̬jtPh̬jh h̬j hSUXt6u!jPCPS* uʋt6u!jPCPgS uʋt6u!jPCP'S uʃ=u hjajtJ;u5tt #jjPCPuD$(Pƃ~2t(93uVCPhju؃jR L$t€:tB?-/bin/sh-cexec malloc failedBummer, could not run '%s': %s /etc/fstabmount proc /proc -t procswapon -aSorry, your computer does not have enough memory. The system is going down NOW !! Sending SIGTERM to all processes. Sending SIGKILL to all processes. ResetCTRL-ALT-DELThe system is halted. Press %s or turn off power Please stand by while rebooting the system. Memory allocation failure r/etc/inittab/sbin/reboot/sbin/swapoff -a/bin/umount -a -r/etc/init.d/rcSBad inittab entry: %s /dev/linuxrc/init started: %s single-s1initNo more tasks for init -- sleeping forever. Process '%s' (pid %d) exited. Scheduling it for restart. applet not found%s Usage: busybox [function] [arguments]... or: [function] [arguments]... BusyBox is a multi-call binary that combines many common Unix utilities into a single executable. Most people will create a link to busybox for each function they wish to use, and BusyBox will act like whatever it was invoked as. Currently defined functions: , %s%s, BusyBox v0.51 (2002.02.20-03:47+0000) multi-call binaryfile name too long%s: omitting directory%s: not a directorymemory exhaustedinvalid date `%s'invalid option -- %c%s: input/output error -- %s--helpWrite Errortoo few argumentsNames longer than %d chars not supported.Ad<4linuxrcinitbusybox%s Usage: %s %s %s No help available. --helpcannot get system information.%s: : %s%s s}TERM=linux/dev/console "6GYn"2BRbrҍ"2BRbrŽҎ"2BRbrҏ"2BRbrҐ Ԍ (T > Ċ(ooo.symtab.strtab.shstrtab.interp.note.ABI-tag.hash.dynsym.dynstr.gnu.version.gnu.version_r.rel.got.rel.bss.rel.plt.init.plt.text.fini.rodata.data.eh_frame.ctors.dtors.got.dynamic.sbss.bss# 1((,7 TT`?RGo To 0c Ċ l ̊ u   ~Ԍ % )) 3 44445LL6LL60L6#!/bin/sh # This script configures support for ethernet cards needed during # installation for an NFS install. echo echo "Network support for NFS install, 17-May-2002 volkerdi@slackware.com" echo # To use a different floppy drive, set this variable first. if [ "$FLOPPY" = "" ]; then FLOPPY="/dev/fd0" fi USEDFLOP=false # Make a mount directory: mkdir -p /network # First, we need to mount the network supplemental disk. while [ 0 ]; do if [ -r /network/scripts/network.sh ]; then umount /network fi unset UMOUNTCDROM echo -n "Searching for network.dsk in /cdrom/isolinux/... " if [ -r /cdrom/isolinux/network.dsk ]; then mount -o loop -o ro /cdrom/isolinux/network.dsk /network echo "found." break else echo "not found." fi echo -n "Searching for network.dsk in /cdrom/rootdisks/... " if [ -r /cdrom/rootdisks/network.dsk ]; then mount -o loop -o ro /cdrom/rootdisks/network.dsk /network echo "found." break else echo "not found." fi echo "Attempting to mount CD-ROM..." # IDE device search: for device in \ /dev/hdd /dev/hdc /dev/hdb /dev/hda /dev/hde /dev/hdf /dev/hdg /dev/hdh \ ; do mount -o ro -t iso9660 $device /var/log/mount 1> /dev/null 2> /dev/null if [ $? = 0 ]; then UMOUNTCDROM=$device break fi done # SCSI device search: if [ "$UMOUNTCDROM" = "" ]; then for device in \ /dev/sr0 /dev/sr1 /dev/sr2 /dev/sr3 \ ; do mount -o ro -t iso9660 $device /var/log/mount 1> /dev/null 2> /dev/null if [ $? = 0 ]; then UMOUNTCDROM=$device break fi done fi # Long shot: if [ "$UMOUNTCDROM" = "" ]; then for device in \ /dev/pcd0 /dev/pcd1 /dev/pcd2 /dev/pcd3 \ ; do mount -o ro -t iso9660 $device /var/log/mount 1> /dev/null 2> /dev/null if [ $? = 0 ]; then UMOUNTCDROM=$device break fi done fi echo -n "Searching for network.dsk in /cdrom/isolinux/... " if [ -r /cdrom/isolinux/network.dsk ]; then mount -o loop -o ro /cdrom/isolinux/network.dsk /network echo "found." break else echo "not found." fi echo -n "Searching for network.dsk in /cdrom/rootdisks/... " if [ -r /cdrom/rootdisks/network.dsk ]; then mount -o loop -o ro /cdrom/rootdisks/network.dsk /network echo "found." break else echo "not found." fi echo echo "Loading network.dsk from floppy disk." echo echo "Please insert the network supplemental diskette (network.dsk), " echo -n "and hit [enter] to continue." read inputjunk; echo mount -t vfat $FLOPPY /network if [ ! -r /network/scripts/network.sh ]; then echo "ERROR: /network/scripts/network.sh not found." echo echo "This does not appear to be the correct disk. Please make sure" echo "the network supplemental diskette (network.dsk) is in the floppy" echo "drive, and hit enter to continue, or control-c to abort." echo if mount | fgrep network 1> /dev/null 2> /dev/null ; then umount /network fi else # Looks correct, but lets check the kernel version: if [ ! -d /network/lib/modules/`uname -r` ]; then echo "WARNING:" echo "Can't find directory /network/lib/modules/`uname -r` on" echo "disk. This disk may be designed for use with a different Linux" echo "kernel version than the one on your bootdisk. This is the" echo "module directory we found:" echo " `echo /network/lib/modules/*`" echo "This disk is not likely to work with your kernel." echo "Press enter to continue anyway, or Q to quit." read inputjunk; if [ "$inputjunk" = "q" -o "$inputjunk" = "Q" ]; then umount /network exit fi fi # If we made it here, then all should be well. break fi done # Now, let's call the network.sh script on the floppy disk to actually # do most of the work: if [ -r /network/scripts/network.sh ]; then sh /network/scripts/network.sh fi # Now, try to make sure that /network gets unmounted... for try in 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 ; do umount /network if mount | grep "on /network " 1> /dev/null 2> /dev/null ; then BAD=verybad else # good! break fi sleep 5 done rmdir /network if [ ! "$UMOUNTCDROM" = "" ]; then echo "Unmounting CD-ROM..." umount /var/log/mount fi if [ "$USEDFLOP" = "true" ]; then echo echo "You may now remove the network supplemental disk." fi echo echo "The next step in your installation may be partitioning your hard drive" echo "(if you're installing to a Linux partition) with 'fdisk' or 'cfdisk'" echo "(the menu-driven version of fdisk). If you already have a partition" echo "prepared for Linux, run 'setup' to start the installer program." echo #!/bin/sh # This script configures support for PCMCIA and/or Cardbus cards needed during # installation, such as a CD-ROM drive or an ethernet card used for an NFS # install. echo echo "PCMCIA/Cardbus support script, 17-May-2002 volkerdi@slackware.com" echo # To use a different floppy drive, set this variable first. if [ "$FLOPPY" = "" ]; then FLOPPY="/dev/fd0" fi USEDFLOP=false # Make a mount directory: mkdir -p /pcmcia # First, we need to mount the PCMCIA supplemental disk. while [ 0 ]; do if [ -r /pcmcia/etc/pcmcia/config.opts ]; then umount /pcmcia fi unset UMOUNTCDROM echo -n "Searching for pcmcia.dsk in /cdrom/isolinux/... " if [ -r /cdrom/isolinux/pcmcia.dsk ]; then mount -o loop -o ro /cdrom/isolinux/pcmcia.dsk /pcmcia echo "found." break else echo "not found." fi echo -n "Searching for pcmcia.dsk in /cdrom/rootdisks/... " if [ -r /cdrom/rootdisks/pcmcia.dsk ]; then mount -o loop -o ro /cdrom/rootdisks/pcmcia.dsk /pcmcia echo "found." break else echo "not found." fi echo "Attempting to mount CD-ROM..." # IDE device search: for device in \ /dev/hdd /dev/hdc /dev/hdb /dev/hda /dev/hde /dev/hdf /dev/hdg /dev/hdh \ ; do mount -o ro -t iso9660 $device /var/log/mount 1> /dev/null 2> /dev/null if [ $? = 0 ]; then UMOUNTCDROM=$device break fi done # SCSI device search: if [ "$UMOUNTCDROM" = "" ]; then for device in \ /dev/sr0 /dev/sr1 /dev/sr2 /dev/sr3 \ ; do mount -o ro -t iso9660 $device /var/log/mount 1> /dev/null 2> /dev/null if [ $? = 0 ]; then UMOUNTCDROM=$device break fi done fi # Long shot: if [ "$UMOUNTCDROM" = "" ]; then for device in \ /dev/pcd0 /dev/pcd1 /dev/pcd2 /dev/pcd3 \ ; do mount -o ro -t iso9660 $device /var/log/mount 1> /dev/null 2> /dev/null if [ $? = 0 ]; then UMOUNTCDROM=$device break fi done fi echo -n "Searching for pcmcia.dsk in /cdrom/isolinux/... " if [ -r /cdrom/isolinux/pcmcia.dsk ]; then mount -o loop -o ro /cdrom/isolinux/pcmcia.dsk /pcmcia echo "found." break else echo "not found." fi echo -n "Searching for pcmcia.dsk in /cdrom/rootdisks/... " if [ -r /cdrom/rootdisks/pcmcia.dsk ]; then mount -o loop -o ro /cdrom/rootdisks/pcmcia.dsk /pcmcia echo "found." break else echo "not found." fi echo echo "Loading pcmcia.dsk from floppy disk." echo echo "Please insert the PCMCIA supplemental diskette (pcmcia.dsk), " echo -n "and hit [enter] to continue." read inputjunk; echo mount -t vfat $FLOPPY /pcmcia if [ ! -r /pcmcia/etc/pcmcia/config.opts ]; then echo "ERROR: /pcmcia/etc/pcmcia/config.opts not found." echo echo "This does not appear to be the correct disk. Please make sure" echo "the PCMCIA supplemental diskette (pcmcia.dsk) is in the floppy" echo "drive, and hit enter to continue, or control-c to abort." echo if mount | fgrep pcmcia 1> /dev/null 2> /dev/null ; then umount /pcmcia fi else # Looks correct, but lets check the kernel version: if [ ! -d /pcmcia/lib/modules/`uname -r`/pcmcia ]; then echo "WARNING:" echo "Can't find directory /pcmcia/lib/modules/`uname -r`/pcmcia on" echo "disk. This disk may be designed for use with a different Linux" echo "kernel version than the one on your bootdisk. This is the" echo "PCMCIA module directory we found:" echo " `echo /pcmcia/lib/modules/*/pcmcia`" echo "You might as well look for the bareapm.i bootdisk of the correct" echo "kernel version, or an updated pcmcia.dsk image. This disk is not" echo "likely to work with your kernel. Press control-c to abort." umount /pcmcia read inputjunk; fi # If we made it here, then all should be well. USEDFLOP=true break fi done # now, set up the support: cp /pcmcia/sbin/killall /tmp/killall ( cd /lib rm -rf modules ln -sf /pcmcia/lib/modules . ) ( cd /sbin for file in /pcmcia/sbin/* ; do if [ -L `basename $file` ]; then rm `basename $file` fi if [ ! -r `basename $file` ]; then ln -sf $file . fi done ) ( cd /etc rm -f pcmcia ln -sf /pcmcia/etc/pcmcia . ) # OK, here goes nothing: /pcmcia/scripts/rc.pcmcia start # Now, the last step. To be able to umount the floppy, we have to kill cardmgr # first. Luckily, once all the PCMCIA modules have been loaded by cardmgr, it # doesn't need to be there for things to continue working. :) echo echo echo "The PCMCIA/Cardbus subsystem is now installed. Please make sure that" echo "all of the cards you'll need for the installation are in the machine." echo "If you still need to insert any PCMCIA/Cardbus cards, do that now. Once" echo "the drive stops (indicating that all needed modules have been" echo -n "loaded), then press [enter] to continue." read inputjunk echo # OK, this is a little tricky. echo "Cleaning up..." sleep 10 # Get rid of rmmod. It causes trouble. :) if [ -L /sbin/rmmod ]; then rm /sbin/rmmod fi # Kill cardmgr with a hard kill so it doesn't even try to unload anything /tmp/killall -9 cardmgr rm -f /tmp/killall # Now, try to make sure that /pcmcia gets unmounted... for try in 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 ; do umount /pcmcia if mount | grep "on /pcmcia " 1> /dev/null 2> /dev/null ; then BAD=verybad else # good! break fi sleep 5 done rmdir /pcmcia if [ ! "$UMOUNTCDROM" = "" ]; then echo "Unmounting CD-ROM..." umount /var/log/mount fi if [ "$USEDFLOP" = "true" ]; then echo echo "You may now remove the PCMCIA supplemental disk." fi echo echo "The next step in your installation may be partitioning your hard drive" echo "(if you're installing to a Linux partition) with 'fdisk' or 'cfdisk'" echo "(the menu-driven version of fdisk). If you already have a partition" echo "prepared for Linux, run 'setup' to start the installer program." echo C ...r<{p VV=Q3= 4#Hu`|̻Y!b;:ry5\_O#`=҈= ֢B! lI&3./U:7j ׎)1Ce٩NVb]hE>B @eB~qo|:OjN˧H-a  @@RIW8X& c H.DA'Ml[Aƃ!AQ6KJ4$[o"5Er yh."TT),?vqpHJn 8}JߧA^2l!|59{9 눚BI/\| ?|s!;wRO>.8??X8 AF sfјgѾohy͛yf'-V7-|XX_'*{MVqhݫl5BxA=XٗQ+qXȗ{=`@Σ!ZT.ki=<ք4Je`!|DE Vxu 29ȺM0 D . ..E arpFatibm>;&Gaudio%*Haudio1T$IaztcdrfJ bpcdKcdu535cLcm206cdMconsoleN cua0O cua1P cua2Q cua3R cua4S eda'T eda1U eda2V eda3W eda4X eda5Y eda6Z eda7[ eda8\ eda9] makedevs.sh^ hdaa_ hdb` hdc[a hddb hdec hdfid hdgTe hdhf fd0gfd0h1200hfd0h1440ifd0u1440j fd1kfd1h1200lfd1h1440mfd1u1440n fullogscd0p icmpq inet|inportbm} ipn!~ kmemlmscd8logibm lp0 mcdCmcdx0 Emcdx18 mem~nrft0W> nst0 nst1 nulloptcd0 par0 par1 par2 pcd0 pcd1 pcd2 pcd3 pdaΓ pda1 pda2 pda3 pda4 pda5 pda6pf0W/o#!/bin/sh # This script makes /dev entries for hard drives listed in /proc/partitions. # Written by Patrick Volkerding, licensed under the GPL (any version). # Copyright 2001, 2002 Slackware Linux, Inc., Concord, CA # Many thanks to Vincent Rivellino for contributing the patches to support # Mylex and Compaq RAID controllers. # Devfs enabled kernels don't use the old familiar device names in # /proc/partitions, so we need to be able to figure them out on the # basis of only the major/minor numbers. This will require some # maintainance for a while, but we expect to require devfs soon enough, # and that will help generalize the installation to new types of # devices without requiring fixes from us. # Also, we're not yet ready to install with devfs _mounted_, so don't # try that. :) # Main loop: # First, determine if we are using old or new device names. The old format # will never contain a '/' (Well, some RAID controllers could have them, # but luckily we can handle those in the same way) # Make a device: makedev() { if [ ! -b $1 ]; then mknod $1 b $2 $3 chown root.disk $1 chmod 640 $1 fi } # Make ide device # makeide major minor hd1 hd2 (2 base devs for major) make_ide() { # Handle base devices: if [ "$2" = "0" ]; then makedev /dev/$3 $1 $2 return 0 elif [ "$2" = "64" ]; then makedev /dev/$4 $1 $2 return 0 fi # Must be a partition: if [ "`expr $2 / 64`" = "0" ]; then DEV=$3 NUM=$2 else DEV=$4 NUM=`expr $2 - 64` fi makedev /dev/$DEV$NUM $1 $2 } # Make SCSI device make_scsi() { # find drive # 0 - 15 DRV=`expr $1 / 16` NUM=`expr $1 % 16` if [ "$NUM" = "0" ]; then NUM="" fi if [ "$DRV" = "0" ]; then makedev /dev/sda$NUM 8 $1 elif [ "$DRV" = "1" ]; then makedev /dev/sdb$NUM 8 $1 elif [ "$DRV" = "2" ]; then makedev /dev/sdc$NUM 8 $1 elif [ "$DRV" = "3" ]; then makedev /dev/sdd$NUM 8 $1 elif [ "$DRV" = "4" ]; then makedev /dev/sde$NUM 8 $1 elif [ "$DRV" = "5" ]; then makedev /dev/sdf$NUM 8 $1 elif [ "$DRV" = "6" ]; then makedev /dev/sdg$NUM 8 $1 elif [ "$DRV" = "7" ]; then makedev /dev/sdh$NUM 8 $1 elif [ "$DRV" = "8" ]; then makedev /dev/sdi$NUM 8 $1 elif [ "$DRV" = "9" ]; then makedev /dev/sdj$NUM 8 $1 elif [ "$DRV" = "10" ]; then makedev /dev/sdk$NUM 8 $1 elif [ "$DRV" = "11" ]; then makedev /dev/sdl$NUM 8 $1 elif [ "$DRV" = "12" ]; then makedev /dev/sdm$NUM 8 $1 elif [ "$DRV" = "13" ]; then makedev /dev/sdn$NUM 8 $1 elif [ "$DRV" = "14" ]; then makedev /dev/sdo$NUM 8 $1 elif [ "$DRV" = "15" ]; then makedev /dev/sdp$NUM 8 $1 fi } # Make Mylex RAID device make_rd() { if [ ! -d /dev/rd ]; then mkdir /dev/rd fi # find drive DRV=`expr $3 / 8` NUM="p`expr $3 % 8`" if [ "$NUM" = "p0" ]; then NUM="" fi makedev /dev/rd/c$1d$DRV$NUM $2 $3 } # Make Cpq SMART/2 RAID device make_ida() { if [ ! -d /dev/ida ]; then mkdir /dev/ida fi # find drive DRV=`expr $3 / 16` NUM="p`expr $3 % 16`" if [ "$NUM" = "p0" ]; then NUM="" fi makedev /dev/ida/c$1d$DRV$NUM $2 $3 } # Make Compaq Next Generation RAID device make_cciss() { if [ ! -d /dev/cciss ]; then mkdir /dev/cciss fi # find drive DRV=`expr $3 / 16` NUM="p`expr $3 % 16`" if [ "$NUM" = "p0" ]; then NUM="" fi makedev /dev/cciss/c$1d$DRV$NUM $2 $3 } if cat /proc/partitions | grep / 1> /dev/null 2> /dev/null ; then # new cat /proc/partitions | grep / | while read line ; do SMASHED_LINE=$line MAJOR=`echo $SMASHED_LINE | cut -f 1 -d ' '` MINOR=`echo $SMASHED_LINE | cut -f 2 -d ' '` if [ "$MAJOR" = "3" ]; then make_ide $MAJOR $MINOR hda hdb elif [ "$MAJOR" = "8" ]; then make_scsi $MINOR elif [ "$MAJOR" = "22" ]; then make_ide $MAJOR $MINOR hdc hdd elif [ "$MAJOR" = "33" ]; then make_ide $MAJOR $MINOR hde hdf elif [ "$MAJOR" = "34" ]; then make_ide $MAJOR $MINOR hdg hdh elif [ "$MAJOR" = "48" ]; then make_rd 0 $MAJOR $MINOR elif [ "$MAJOR" = "49" ]; then make_rd 1 $MAJOR $MINOR elif [ "$MAJOR" = "50" ]; then make_rd 2 $MAJOR $MINOR elif [ "$MAJOR" = "51" ]; then make_rd 3 $MAJOR $MINOR elif [ "$MAJOR" = "52" ]; then make_rd 4 $MAJOR $MINOR elif [ "$MAJOR" = "53" ]; then make_rd 5 $MAJOR $MINOR elif [ "$MAJOR" = "54" ]; then make_rd 6 $MAJOR $MINOR elif [ "$MAJOR" = "55" ]; then make_rd 7 $MAJOR $MINOR elif [ "$MAJOR" = "56" ]; then make_ide $MAJOR $MINOR hdi hdj elif [ "$MAJOR" = "57" ]; then make_ide $MAJOR $MINOR hdk hdl elif [ "$MAJOR" = "72" ]; then make_ida 0 $MAJOR $MINOR elif [ "$MAJOR" = "73" ]; then make_ida 1 $MAJOR $MINOR elif [ "$MAJOR" = "74" ]; then make_ida 2 $MAJOR $MINOR elif [ "$MAJOR" = "75" ]; then make_ida 3 $MAJOR $MINOR elif [ "$MAJOR" = "76" ]; then make_ida 4 $MAJOR $MINOR elif [ "$MAJOR" = "77" ]; then make_ida 5 $MAJOR $MINOR elif [ "$MAJOR" = "78" ]; then make_ida 6 $MAJOR $MINOR elif [ "$MAJOR" = "79" ]; then make_ida 7 $MAJOR $MINOR elif [ "$MAJOR" = "80" ]; then make_ide $MAJOR $MINOR hdm hdn elif [ "$MAJOR" = "89" ]; then make_ide $MAJOR $MINOR hdo hdp elif [ "$MAJOR" = "90" ]; then make_ide $MAJOR $MINOR hdq hdr elif [ "$MAJOR" = "91" ]; then make_ide $MAJOR $MINOR hds hdt elif [ "$MAJOR" = "104" ]; then make_cciss 0 $MAJOR $MINOR elif [ "$MAJOR" = "105" ]; then make_cciss 1 $MAJOR $MINOR elif [ "$MAJOR" = "106" ]; then make_cciss 2 $MAJOR $MINOR elif [ "$MAJOR" = "107" ]; then make_cciss 3 $MAJOR $MINOR elif [ "$MAJOR" = "108" ]; then make_cciss 4 $MAJOR $MINOR elif [ "$MAJOR" = "109" ]; then make_cciss 5 $MAJOR $MINOR elif [ "$MAJOR" = "110" ]; then make_cciss 6 $MAJOR $MINOR elif [ "$MAJOR" = "111" ]; then make_cciss 7 $MAJOR $MINOR fi done else # old format cat /proc/partitions | grep d | while read line ; do SMASHED_LINE=$line MAJOR=`echo $SMASHED_LINE | cut -f 1 -d ' '` MINOR=`echo $SMASHED_LINE | cut -f 2 -d ' '` DEVNAME=`echo $SMASHED_LINE | cut -f 4 -d ' '` makedev /dev/$DEVNAME $MAJOR $MINOR done fi q .D ..r iplas icmpt ggpzu ipipv tcp-w egp x puply udpuz idpw{|rawipr 6277 2000-08-16 12:05:59 emacs-21.2/lisp/play/cookie1.el -rw-rw-rw- eliz/user 43425 2001-07-16 02:10:19 emacs-21.2/lisp/play/decipher.el -rw-rw-rw- eliz/user 3306 2001-07-15 09:15:35 emacs-21.2/lisp/play/dissociate.el -rw-rw-rw- eliz/user 52104 2001-10-23 09:16:47 emacs-21.2/lisp/play/doctor.el -rw-rw-rw- eliz/user 114295 2001-07-16 02:10:19 emacs-21.2/lisp/play/dunnet.el -rw-rw-rw- eliz/user 11113 2001-07-23 02:57:37 emacs-21.2/lisp/play/fortune.el -rw-rw-rw- eliz/user 12518 2002-02-06 03:50:36 emacs-21.2/lisp/play/gamegrid.el -rw-rw-rw- eliz/user 24886 1999-01-29 23:26:04 emacs-21.2/lisp/play/gametree.el -rw-rw-rw- eliz/user 44597 2001-11-20 10:40:55 emacs-21.2/lisp/play/gomoku.el -rw-rw-rw- eliz/user 67631 2001-07-17 00:37:19 emacs-21.2/lisp/play/handwrite.el -rw-rw-rw- eliz/user 17584 2001-07-15 09:15:35 emacs-21.2/l pf1 pf2 pf3 portpsauxptyp0ptyp1ptyp2ptyp3ptyp4ptyp5ptyp6ptyp7ptyp8 ram0 rft0rmt16 rmt8sbpcdsbpcd0sbpcd1 scd1 scd2 sga sgb sgc sgd sge sgf sgg sgh sjcdsocketsocksyssonycd spx st0 st1tape-d tape-reset tcp tty tty0 tty1 tty2 tty3 tty4 tty5 tty6 tty7 tty8 tty9ttyS0ttyS1ttyS2ttyS3ttyS4ttyp0ttyp1ttyp2ttyp3ttyp4ttyp5ttyp6ttyp7ttyp8 udp unix zero ram1fd0u1680fd0u1722hdi hdj hdk hdl hdm hdn hdo hdp hdq hdr hds hdt scd3 scd4 sr1 sr2 sr3 sr4 sr0 scd0 rd idaloop0loop1loop3loop4ataraidparport0parport1parport2parport3ccissamiraid md0 md1 md2 md3$pts .D..S擬tξ\ԙ%,/M>;LYDcxŒϬAp%ݞe4glkQh0t^t0i#` ~UWՒ>ԲlaGOTQD4A DI)r8Yqqqj М:Q(.QESP$ Vt/4qP":~aۭZ&2b-gdw3ZdAbA$-$DmfK}w%&.#&=,okV/#yۚ+$؇k..{=9}ю5vOlPIa.ٳg+9֢ R]Lso϶i7Y[9@?]~S?h9 UY30ՉXILRqX0W "R 1zdM;cA[u7zg[]-zmoli/.| |ʾA<7Nua-S&16FPOfD<zեH0fN·kJXD iU:s`sX@y\k'8fFA `cV~n ieJ q Mߧ'E1^IP&h'E-l}!^a9 \ xᘘ6{CV2j|A^ |WwYu? /k^/a #2/0?*ާ?_V//]Ű1X U_#$,B?v<2>įVV\j{Y_jj=_\~Fd3"3 @ ?CiyKN;$I1pUOW, .D..v}k׫/lJ`T0~{m.!$'nJzmiIuVv2]Ih'MyV{+!XddV'Ĝǫ6@J~IO5F((Nw03 | Ҟ1tL~s40 Fowo8&0lx 5Fi5j('Ou=ϣśChd@DbE29"0FRM+lӵڑ5DFImeIq1+[(3wkZyRyBٸ6C3F[sG6Vj#×}l֝\NǞaŭ'< ,JUMaіV.Z][Yє ݵ]u5_n6IK zYR魗Zr[7Pu; "fHY3' P-=i3i %1Q\& \˴ %lFq,rui4sR@ sRT-hu(S !0I1WQS«<{CM 3 ߙ52RY|-.#o:4=}zaoKқF/אC$ðܳnQUyugt^Op'eF{f .D..u^,vJk}F!?kZ=sSmoݧLYe8aLj` {ꢥ%cYupǖ$4B f(uJfuekZyM%Nb9gQH $޷^Xt<&._qҷ_!׏!kǍ9k9S۷q}}EoXc=1:9aU_3ћ "Toc% =y+iJ2 4vEЈwu ._4Io2נ׿1[9m/|Qhk,5 _ovI$ ɘ)>"|12v.'&Li8)5t@8aݖRW5)Z{q~:z CMRakv:E Z̪xQ 2Ѐ>ib@ͳZ CtctiVԢܪ j"nb.9{F?RGv~=%%%%%%%$T U?{XRVJJURRBOGielf6%%%%%-))21LA }Znq8K0g'e[8nV_]!afx`͛~GvZԩv6[,[xaejR'azo8:}|xwXEJSwcfOxsK .D..)z_/%ESREj 0λ?Xl>?jtbn1* 4THE=OlRb"B=WΆ{X\# ӧPMc"  N:u>:h÷J~d3C=AAE~o4Z.yyq"buqoK4l?4u"8sZw|~ɍI؁ȫᶝW<)t O*/$1$"@gAZAӞw.8vr˒MF)S㼜3>??j#La#5VO rmg߳u  *` ,kqҲ E?Vd酿 o|~8}e5q_wokCC&_PD>=ZWavHu;DDMIea>ti )!HY&;;s+'m2UK"G"cOYr'494?fD] g8u4~Xt1փHhҜ'H j2}<%~SM7.dɿRܡl4YĤ$ dIimI1NHI$ 0PQk2dlb(v '-7o '6җ vNցɵ'g ?J.2S+ޓQ#AGw'7Ov9N KΉQLը_maPFth LcBa&B;CIHI&ss)'zgm_e:pa;@M\]v0ٲ) NXbq0 =z̼^M0 U|1#X5&.&%*h}FTXx^ޏVD6 @ 5*o꩒+j=nfSx̐"( .D..^ZN!(cr LmUH'"";JOG /{2zO{yQň=cZ\=9M@#G^@\^@P#JX 7% '<:bRWr^ {B9|{=Oɕ1" `vBg$Pr WVU8REA4QxOFKAW<T) nͤw~njJiG$~G_"LO!$ Xt_VΛ-1s`$B J_ֹ42rI翰D% @!bA!8^۾/yߟY-[4g#6@.׷8 ¡:(צ\GU&23W=UUdXU.fbiLʙUƱ D(&Zʤʆ[Wki|^n/_D {` 0;J7pm6|Ak þx֔RCP.?{"ǃ=ma K'AB\M=&O\*k`ˀ 蕾3 ? Z?X5rhS!818cM &Xy/$!<5~Boċ:Qx?}x.L$6ڸ D}3%ô.?tOEG6Q]\maNn`(%43S(9 R%Dېn9Zlp|_NV3'%D{ vXJ?Fhƌ`^-3 00KMT_%$mbEm__iuZ0N19pts7@!Oz3?w_sMk -biQ;KjBg20?ӝHլ[f+P . .. fstabf groupc  host.confi hosts@ inittabissueXr  ld.so.cache  ld.so.conf4_ login.defs motd mtabpasswd3profile rc.dservicesshellsv syslog.conf/termcap nsswitch.conf=?shadowX securettyN networks!HOSTNAME"dialogrc#keymaps.tar.gz$ mtools.conf%(slackware-versionwXi@DJP CSAnlj@ax\r hg&-TlX{2|ϲSlVJ g7PA-P 6i^vP,EicG|hHBȌGH@~Q:O)v9 3\ڞ~mfg"Z|9gOM֛]2=o]obTOXLb:$0PHeIIx83ǡX,Q#BkgO-.G\;7lXq@4Wy[]\2՞@şBPIsXJ8dȻY<ɗ<|15:>t4@;77b+ӏY~bhܖ+;4gXf says that 127.0.0.1 # should NEVER be named with the name of the machine. It causes problems # for some (stupid) programs, irc and reputedly talk. :^) # # For loopbacking. 127.0.0.1 localhost # This next entry is technically wrong, but good enough to get TCP/IP apps # to quit complaining that they can't verify the hostname on a loopback-only # Linux box. 127.0.0.1 slackware.example.net slackware # End of hosts. # /etc/inittab # Boot-time system configuration/initialization script. # This is run first except when booting in single-user mode. ::sysinit:/etc/rc.d/rc.S # Login /bin/sh invocations on selected ttys. # # Start a shell on the console ::respawn:-/bin/sh # Start an "askfirst" shell on tty2 and tty3 tty2::askfirst:-/bin/sh tty3::askfirst:-/bin/sh # /sbin/getty invocations for selected ttys. # #tty1::respawn:/sbin/getty 38400 tty1 #tty2::respawn:/sbin/getty 38400 tty2 # Example of how to put a getty on a serial line (for a terminal) # #ttyS0::respawn:/sbin/getty -L ttyS0 9600 vt100 #ttyS1::respawn:/sbin/getty -L ttyS1 9600 vt100 # # Example how to put a getty on a modem line. #ttyS2::respawn:/sbin/getty -x0 -s 57600 ttyS2 # Reboot when ctrl-alt-del keys are pressed. #::ctrlaltdel:/sbin/reboot ::ctrlaltdel:/sbin/brc # Stuff to do before halting or rebooting. ::shutdown:/sbin/swapoff -a >/dev/null 2>&1 ::shutdown:/bin/umount -a -r >/dev/null 2>&1 Welcome to the Slackware Linux simple rescue disk! (version 8.1.0) You may now login as 'root'. ld.so-1.7.0$-<P`u&>Pgw+?IXdu#,:GYgz '5glibc-ld.so.cache1.1$-<P`u&>Pgw+?IXdu#,:GYgz '5libuuid.so.1/lib/libuuid.so.1libutil.so.1/lib/libutil.so.1libthread_db.so.1/lib/libthread_db.so.1libss.so.2/lib/libss.so.2librt.so.1/lib/librt.so.1libresolv.so.2/lib/libresolv.so.2libpthread.so.0/lib/libpthread.so.0libproc.so.2.0.7/lib/libproc.so.2.0.7libpcprofile.so/lib/libpcprofile.solibnss_nisplus.so.2/lib/libnss_nisplus.so.2libnss_nis.so.2/lib/libnss_nis.so.2libnss_hesiod.so.2/lib/libnss_hesiod.so.2libnss_files.so.2/lib/libnss_files.so.2libnss_dns.so.2/lib/libnss_dns.so.2libnss_db.so.2/lib/libnss_db.so.2libnss_compat.so.2/lib/libnss_compat.so.2libnsl.so.1/lib/libnsl.so.1libncurses.so.5/lib/libncurses.so.5libmemusage.so/lib/libmemusage.solibm.so.6/lib/libm.so.6libgpm.so.1/lib/libgpm.so.1libe2p.so.2/lib/libe2p.so.2libext2fs.so.2/lib/libext2fs.so.2libdl.so.2/lib/libdl.so.2libdb1.so.2/lib/libdb1.so.2libdb.so.3/lib/libdb.so.3libdb.so.2/lib/libdb.so.2libdb.so/lib/libdb.solibdb-3.1.so/lib/libdb-3.1.solibcrypt.so.1/lib/libcrypt.so.1libcom_err.so.2/lib/libcom_err.so.2libc.so.6/lib/libc.so.6libanl.so.1/lib/libanl.so.1libSegFault.so/lib/libSegFault.solibBrokenLocale.so.1/lib/libBrokenLocale.so.1ld-linux.so.2/lib/ld-linux.so.2/cdrom/live/lib /cdrom/live/usr/lib /cdrom/live/usr/local/lib /cdrom/live/usr/X11R6/lib # # /etc/login.defs - Configuration control definitions for the login package. # # $Id: login.defs.linux,v 1.10 1999/03/07 19:14:33 marekm Exp $ FAIL_DELAY 3 DIALUPS_CHECK_ENAB yes FAILLOG_ENAB yes LOG_UNKFAIL_ENAB no LOG_OK_LOGINS no LASTLOG_ENAB yes MAIL_CHECK_ENAB no OBSCURE_CHECKS_ENAB yes PORTTIME_CHECKS_ENAB yes QUOTAS_ENAB yes SYSLOG_SU_ENAB yes SYSLOG_SG_ENAB yes CONSOLE /etc/securetty #CONSOLE console:tty01:tty02:tty03:tty04 #SULOG_FILE /var/log/sulog MOTD_FILE /etc/motd #MOTD_FILE /etc/motd:/usr/lib/news/news-motd #ISSUE_FILE /etc/issue #TTYTYPE_FILE /etc/ttytype FTMP_FILE /var/log/btmp NOLOGINS_FILE /etc/nologin SU_NAME su #QMAIL_DIR Maildir MAIL_DIR /var/spool/mail #MAIL_FILE .mail HUSHLOGIN_FILE .hushlogin #HUSHLOGIN_FILE /etc/hushlogins NOLOGIN_STR NOLOGIN #ENV_TZ TZ=CST6CDT #ENV_TZ /etc/tzname ENV_HZ HZ=100 #ENV_HZ HZ=1024 ENV_SUPATH PATH=/usr/local/sbin:/usr/local/bin:/sbin:/usr/sbin:/bin:/usr/bin ENV_PATH PATH=/usr/local/bin:/bin:/usr/bin TTYGROUP tty TTYPERM 0620 ERASECHAR 0177 KILLCHAR 025 UMASK 022 #ULIMIT 2097152 PASS_MAX_DAYS 99999 PASS_MIN_DAYS 0 PASS_MIN_LEN 5 PASS_WARN_AGE 7 SU_WHEEL_ONLY no #CRACKLIB_DICTPATH /var/cache/cracklib/cracklib_dict UID_MIN 1000 UID_MAX 60000 GID_MIN 100 GID_MAX 60000 LOGIN_RETRIES 5 LOGIN_TIMEOUT 60 PASS_CHANGE_TRIES 5 PASS_ALWAYS_WARN yes #PASS_MAX_LEN 8 CHFN_AUTH yes CHFN_RESTRICT frwh #LOGIN_STRING "%s's Password: " MD5_CRYPT_ENAB yes #CONSOLE_GROUPS floppy:audio:cdrom DEFAULT_HOME yes ENVIRON_FILE /etc/environment #USERDEL_CMD /usr/sbin/userdel_local #NO_PASSWORD_CONSOLE tty1:tty2:tty3:tty4:tty5:tty6 No mail. "As far as we know, our computer has never had an undetected error." -- Weisert This is a simple one-floppy rescue disk with most of the basic utilities that you'd need to get yourself out of trouble. Because space is limited here, larger things like e2fsck, reiserfsck, and fsck.xfs could not be included, but you can probably still run these from your hard drive by mounting the partition and chrooting to it (even fsck if you mount read-only): mount /dev/hda1 /mnt -o ro chroot /mnt /bin/bash /sbin/e2fsck -v -v -y /dev/hda1 Good luck! :-) root:x:0:0::/root:/bin/bash bin:x:1:1:bin:/bin: daemon:x:2:2:daemon:/sbin: adm:x:3:4:adm:/var/adm: lp:x:4:7:lp:/var/spool/lpd: sync:x:5:0:sync:/sbin:/bin/sync shutdown:x:6:0:shutdown:/sbin:/sbin/shutdown halt:x:7:0:halt:/sbin:/sbin/halt mail:x:8:12:mail:/var/spool/mail: news:x:9:13:news:/usr/lib/news: uucp:x:10:14:uucp:/var/spool/uucppublic: operator:x:11:0:operator:/root:/bin/bash ftp:x:14:1::/home/ftp:/bin/bash smmsp:x:25:25:smmsp:/var/spool/clientmqueue: nobody:x:99:99:nobody:/dev/null: # commands common to all logins PATH="$PATH:/bin:/sbin:/usr/bin:/usr/lib/setup" PATH="$PATH:/mnt/usr/local/bin:/mnt/usr/bin:/mnt/bin" PATH="$PATH:/mnt/usr/local/sbin:/mnt/usr/sbin:/mnt/sbin" PATH="$PATH:/mnt/linux/usr/local/bin:/mnt/linux/usr/bin:/mnt/linux/bin" PATH="$PATH:/mnt/linux/usr/local/sbin:/mnt/linux/usr/sbin:/mnt/linux/sbin" PATH="$PATH:/cdrom/live/usr/local/bin:/cdrom/live/usr/bin" PATH="$PATH:/cdrom/live/bin:/cdrom/live/usr/local/sbin" PATH="$PATH:/cdrom/live/usr/sbin:/cdrom/live/sbin" PATH="$PATH:/cdrom/live/usr/X11R6/bin:." LESS=-MM TERM=linux PS1='\u@\h:\w\# ' PS2='> ' ignoreeof=10 export PATH DISPLAY LESS TERM PS1 PS2 ignoreeof umask 022  . ..rc.inet1rc.SF~_/jp`DCGEV +Ӷ= yMUTt%{_FcvGvV>"Ưr7tw98't1Lz &A;x3+}#og)qQfɚ;;HxS>>ow,;%O\a8Kfҙf/&\ÐK_߇(COlb&{JI<,! $$Ik>DOvsM{TM̍ hye"bw-,hy/ ZcaS$!&Ld0-{b$iD+ $dsFWB|v+HjD/?V~oߓNzp]0[NR8x^Co ?wo0,R?C`M&|F!q\L$C%&O=3_FH!/j!5N *&dO$`tIC[)gn=[mg& 8 0& vyv =>AqD*m}P =Kb\^:$7yY0a0& Bcofs3IN5\&LME&t4*CQɻ\wR2~5d@wmgӂ0=hM$ IEu:pXܯ(#aH[-HLkqq?O8<&4BBLJW@Uڹ"o1c!L^O=M3. :4/l\]ׇ3,91=}ݎ* "(&O2(0{|#1yzqQu0qL̕srŀJ"u.-o;u#! /bin/sh # # rc.inet1 This shell script boots up the base INET system. # # Version: @(#)/etc/rc.d/rc.inet1 1.01 05/27/93 # HOSTNAME=`cat /etc/HOSTNAME` /bin/hostname `cat /etc/HOSTNAME | cut -f1 -d .` # Attach the loopback device. /sbin/ifconfig lo 127.0.0.1 /sbin/route add -net 127.0.0.0 netmask 255.0.0.0 lo #!/bin/sh # remove /etc/mtab* so mount creates the /etc/mtab file /bin/rm -f /etc/mtab* /etc/nologin /bin/mount -av -t nonfs /sbin/swapon -a 2> /dev/null # Make detected partitions: /dev/makedevs.sh if [ -x /etc/rc.d/rc.inet1 ]; then /bin/sh /etc/rc.d/rc.inet1 fi /sbin/syslogd 2> /dev/null sleep 1 /sbin/klogd 1> /dev/null # Doesn't work here, since there's no "dialog", but we'll leave the # source for Luke to read, as you could figure out how to load maps by # hand from that... #echo #echo "